SecReT6
Protein ID: 104779798
SecReT6 ID125
T6SS typei1
Gene symbol-
Locus tagPSEEN0533
StrainPseudomonas entomophila L48
Repliconchromosome [GenBank: NC_008027] [Browse all T6SS(s) in this replicon]
Location [Strand]550500..551831 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ1IFS3
KEGG IDpen:PSEEN0533
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.90E-139, Aligned region: 18..442
Protein Sequence: 443 a.a.     [Download]
>gi|104779798|ref|YP_606296.1| hypothetical protein PSEEN0533 [Pseudomonas entomophila L48]
MNVHKVVWQEGMLLRPQHFQHNDRYYDSQMKTRTQLLGTYTWGFINLEIDLQFLNMGKLVISRAAGILPD
GSLFELDGSSEPLALDVPPNTGATPIFMALPLVTGNHIEARRPEQSDVLTRYTTYEVEVSDSNAGDDNSS
QINCARPDFRLLLGEQQTDQAYVKLKVCEILDTSPDGVISLDPDFVPTFIRTHSSVYLLSCLKEVISMLA
LRGDTLAERIRSNGKVGGAEVGDFMMLQLINRTELLLRHYLSLEQVHPEELYRTFLIMLGDLSTFSSDTK
RPRLDARYQHSDQGASFRKLMESIRQVLSMVLEQHAIELELQQRQYGILVSPLHDPGLLTTASFVLAASA
NCESEELRQRLPSHLKVGPVERIRQLVNLHLPGLKVKPLPVAPRQIPFHANKTYFIVELDAADRAKMDGS
GGFAFHVTSEFSDLELKFWAIRN
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|104779316|ref|NC_008027.1|:550500-551831 Pseudomonas entomophila L48 chromosome, complete genome
ATGAATGTGCACAAGGTAGTCTGGCAGGAGGGGATGCTGCTGCGTCCCCAGCATTTCCAGCACAACGACC
GTTACTACGACAGCCAGATGAAGACCCGCACCCAGTTGCTGGGTACCTACACCTGGGGCTTCATCAACCT
GGAAATCGACCTGCAGTTCCTCAACATGGGCAAGCTGGTGATCAGCCGCGCCGCCGGCATCCTGCCCGAC
GGCAGCCTGTTCGAGCTCGACGGCAGCAGCGAGCCGCTGGCCCTGGACGTGCCGCCGAACACCGGCGCTA
CGCCGATCTTCATGGCCCTGCCGCTGGTCACCGGCAACCACATCGAGGCACGCCGCCCCGAGCAGTCCGA
TGTGCTGACCCGCTACACCACCTACGAGGTGGAGGTGTCCGACTCCAACGCCGGCGACGACAACAGCAGC
CAGATCAACTGCGCGCGCCCCGACTTCCGCCTGCTGCTGGGCGAGCAGCAGACCGACCAGGCCTACGTGA
AGCTCAAGGTCTGCGAGATCCTCGACACCTCGCCCGACGGCGTGATCAGCCTCGACCCGGACTTCGTGCC
GACCTTCATCCGCACCCACTCCTCGGTGTACCTGCTGTCGTGCCTGAAGGAAGTCATCAGTATGCTGGCG
CTGCGCGGCGACACCCTGGCCGAGCGTATCCGCTCCAACGGCAAGGTCGGTGGCGCCGAGGTCGGCGACT
TCATGATGCTGCAGCTGATCAACCGTACCGAACTGCTGCTGCGCCACTACCTGAGCCTGGAGCAGGTGCA
CCCCGAAGAGCTGTACCGCACCTTCCTGATCATGCTGGGTGACCTGTCGACTTTCTCCAGCGACACCAAG
CGCCCGCGCCTGGATGCCCGCTACCAGCACAGCGACCAGGGCGCGAGCTTCCGCAAACTGATGGAGTCGA
TCCGCCAGGTGCTGTCGATGGTGCTCGAGCAGCACGCCATCGAGCTGGAACTGCAGCAGCGCCAGTACGG
CATCCTGGTCTCGCCGCTGCACGACCCGGGCCTGCTCACCACCGCCTCGTTCGTGCTGGCGGCCAGCGCC
AACTGCGAGTCCGAGGAGCTGCGCCAGCGCCTGCCGTCGCACCTGAAGGTCGGCCCGGTGGAGCGCATCC
GCCAGCTGGTCAACCTGCACCTGCCGGGGCTCAAGGTCAAACCGTTGCCGGTGGCGCCGCGGCAGATCCC
GTTCCACGCCAACAAGACCTACTTCATCGTCGAACTCGACGCCGCCGACCGCGCCAAGATGGACGGCTCC
GGTGGCTTCGCCTTCCACGTCACCAGTGAGTTCTCCGATCTCGAACTGAAATTCTGGGCCATCAGGAACT
GA