SecReT6
Protein ID: 104779804
SecReT6 ID125
T6SS typei1
Gene symbol-
Locus tagPSEEN0540
StrainPseudomonas entomophila L48
Repliconchromosome [GenBank: NC_008027] [Browse all T6SS(s) in this replicon]
Location [Strand]559133..562153 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ1IFR7
KEGG IDpen:PSEEN0540
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.90E-66, Aligned region: 30..322
Phage_GPD [PF05954], Evalue: 1.90E-66, Aligned region: 564..572
DUF2345 [PF10106], Evalue: 2.60E-47, Aligned region: 615..765
DUF2345 [PF10106], Evalue: 2.60E-47, Aligned region: 933..958
T6SS_Vgr [PF13296], Evalue: 2.60E-34, Aligned region: 476..583
T6SS_Vgr [PF13296], Evalue: 2.60E-34, Aligned region: 929..945
Phage_base_V [PF04717], Evalue: 3.60E-22, Aligned region: 371..463
Protein Sequence: 1006 a.a.     [Download]
>gi|104779804|ref|YP_606302.1| hypothetical protein PSEEN0540 [Pseudomonas entomophila L48]
MFAAADQTHFSLHIDGLEHDFQVLAFDGSEAISQVYAIDLELVSEHPSRDLESLLHKPAFLQLGDDGRGL
HGLIYRAAQGEAGKRLTRYQVTLRPQLAYLAHRINQRMFQQLSVPKIIAQVLEEHGILANAYQFQLGAVY
PEREYCVQYDESNLQFVQRLCEEEGIHYHFRHSAEGHQLVFGDDQTVFRKLAPVAYQQDAGLVADTPMIK
RFGLRVETRTSSVTRRDYDFKKPLIQLEGESVSHAEPELEDYDYPGRFLDRARGKHLATRALERHRSDFR
LAEGRSDQPLLASGHFLTLSAHPNAAWNDLWLLTDVHHQGRQPQVLEEAITSDVDAKYDGFQQGYRNFFS
ATPWDATYRPPLEHPKPRILGTQRAVVSGPAGEEIYCDEYGRIKVQFFWDREGRSDDKSSVWMRVASGWA
GQGIASLQLPRVGMEVLVSFLEGDPDQPLVTGCLYHGVNMPHYKLPDLKTLATIKSKEYKGSRNNELRID
DTTSEISIALRSDHGASALNLGYLTHPRPSGGAPRGEGFELRTDRHGAVRAAGGLLITTEPRANEAKHHK
DLPETAERLATASEQQDSLAELAKQMQAQEPGDQDAVAKRLHEQHQGILGSGPVNQSANEFPEFAQPHLV
LSSPAGIALTTPGPNHITTGEHLALSSTGHTSMSVGKRLLASASQGMRLFVQSLGWKLVSASGDIDIRAL
KDNINLLAKLDITANADRIVLTAKTELVIQGGGSATTYNAGGITHVTSANYTAHAAQFAHIGAASKAGTF
PEPPKPGKGDLELLYQYANSKGVKTGDYDVIDALGKSIKGKLDGNGFNQASGAAAGPLWVDFGLDPADTW
AEGSHFGAGDWPPKPSFADIAPGQQAVVGEVLSGGKGAEGLLGKGLALAQQGMDKGKGLMQNAMAQGKSM
AQGLMGPGGNGLLEQGKALAGTGMQLAKSGQAALQKAQQVKAAVGGDTGAMAQLASNVVPGAAPTLKAAS
ALKQLPSLPKLSAPVNPAKLNHEVLA
 
Nucleotide Sequence: 3021 bp     [Download]
>gi|104779316|ref|NC_008027.1|:559133-562153 Pseudomonas entomophila L48 chromosome, complete genome
ATGTTTGCCGCCGCCGACCAGACCCATTTCAGCTTGCACATCGACGGCCTGGAGCACGACTTCCAGGTAC
TCGCCTTCGACGGCAGCGAAGCCATCAGCCAGGTGTACGCCATCGACCTGGAACTGGTCAGCGAGCACCC
CTCGCGGGACCTGGAGAGCCTGCTGCACAAGCCCGCGTTCCTCCAGCTCGGCGACGACGGCCGCGGCCTG
CACGGCCTGATCTACCGCGCCGCGCAAGGCGAGGCGGGCAAGCGCCTGACCCGCTACCAGGTTACGCTAC
GCCCGCAGCTGGCCTACCTGGCCCACCGCATCAACCAACGCATGTTCCAGCAACTGAGCGTGCCGAAGAT
CATCGCCCAGGTACTGGAAGAGCACGGCATCCTCGCCAACGCCTACCAGTTCCAGCTGGGCGCCGTGTAC
CCGGAGCGTGAGTACTGCGTGCAGTACGACGAGTCCAACCTGCAATTCGTCCAGCGCCTGTGCGAAGAAG
AGGGCATCCACTACCACTTCCGCCATAGCGCCGAGGGCCACCAGCTGGTGTTCGGCGACGACCAGACCGT
GTTCCGCAAGCTGGCCCCGGTGGCCTACCAGCAGGACGCCGGGCTGGTGGCCGACACGCCGATGATCAAG
CGCTTCGGCCTGCGCGTGGAAACCCGCACCAGCAGCGTCACCCGCCGCGACTACGACTTCAAGAAACCGC
TGATCCAGCTCGAAGGCGAGTCGGTCAGCCACGCCGAGCCCGAGCTCGAAGACTATGACTACCCCGGGCG
CTTCCTCGACCGCGCCCGCGGCAAGCACCTGGCCACCCGCGCCCTGGAGCGCCACCGCAGCGACTTCCGC
CTGGCCGAAGGGCGCAGCGACCAGCCGTTGCTGGCCAGCGGGCATTTCCTGACCCTGAGCGCGCACCCCA
ACGCCGCCTGGAACGACCTCTGGCTGCTCACCGACGTGCACCACCAGGGCCGCCAGCCCCAGGTGCTGGA
AGAAGCCATCACCAGCGACGTCGACGCCAAGTACGACGGCTTCCAGCAGGGCTACCGCAATTTCTTCAGC
GCCACCCCGTGGGACGCCACCTACCGCCCGCCGCTCGAACACCCCAAGCCGCGCATCCTCGGCACCCAGC
GCGCCGTGGTCAGCGGCCCGGCCGGTGAAGAGATCTACTGCGACGAGTACGGCCGCATCAAGGTGCAGTT
CTTCTGGGACCGCGAAGGCCGCTCCGATGACAAGTCCAGCGTGTGGATGCGCGTGGCCTCCGGCTGGGCC
GGGCAGGGCATCGCCAGCCTGCAGCTGCCCCGGGTCGGCATGGAGGTGCTGGTCAGCTTCCTCGAAGGTG
ACCCCGACCAGCCCCTGGTGACCGGTTGCCTGTACCACGGCGTGAACATGCCGCACTACAAGCTGCCCGA
CCTGAAGACCCTGGCCACCATCAAGAGCAAGGAATACAAGGGCAGCCGCAACAACGAACTGCGCATCGAC
GACACCACCAGCGAAATCAGCATCGCCCTGCGTAGCGACCACGGCGCCAGTGCGCTGAACCTGGGCTACC
TCACGCACCCCAGACCGTCGGGCGGCGCCCCCCGTGGCGAAGGCTTTGAGCTGCGCACCGACCGCCACGG
CGCCGTGCGCGCGGCCGGCGGCCTGCTGATCACCACCGAGCCCCGCGCCAACGAAGCCAAGCACCACAAG
GACCTGCCGGAAACCGCCGAACGCCTGGCCACCGCCAGCGAACAGCAGGACAGCCTGGCGGAACTGGCCA
AGCAGATGCAGGCCCAGGAACCCGGCGACCAGGATGCCGTGGCCAAGCGCCTGCACGAGCAGCACCAGGG
TATCCTCGGCAGCGGCCCGGTCAACCAGAGCGCCAACGAGTTCCCCGAATTCGCCCAGCCGCACCTGGTG
CTGTCGAGCCCGGCCGGCATCGCCCTGACCACCCCCGGCCCCAACCACATCACCACCGGCGAGCATCTGG
CCCTGAGCAGCACCGGCCACACCAGCATGTCCGTCGGCAAGCGCCTGCTGGCCAGCGCCAGCCAGGGCAT
GCGCCTGTTCGTGCAGAGCCTGGGCTGGAAACTGGTGTCGGCCTCCGGCGACATCGACATCCGCGCCCTC
AAGGACAACATCAACCTGCTGGCCAAGCTGGACATCACCGCCAACGCCGACCGCATCGTGCTCACCGCCA
AGACCGAGCTGGTGATCCAGGGCGGCGGCAGCGCCACCACCTACAACGCCGGCGGCATCACCCATGTCAC
CAGCGCCAACTACACCGCCCACGCCGCGCAGTTCGCCCATATCGGCGCCGCCAGCAAGGCCGGCACCTTC
CCCGAACCACCGAAACCCGGCAAGGGCGACCTGGAGCTGCTGTACCAGTACGCCAACAGCAAAGGCGTGA
AGACCGGTGACTACGACGTGATCGACGCCCTGGGCAAATCGATCAAGGGCAAGCTCGACGGCAACGGTTT
CAACCAGGCCAGCGGCGCCGCCGCCGGCCCGCTGTGGGTCGACTTCGGCCTGGACCCGGCCGACACCTGG
GCCGAGGGCAGCCACTTCGGCGCCGGCGACTGGCCACCCAAGCCCAGCTTCGCCGACATCGCCCCCGGCC
AGCAGGCCGTGGTTGGCGAGGTACTCAGCGGCGGCAAGGGCGCAGAGGGGTTGCTGGGCAAGGGCCTGGC
ACTGGCACAGCAAGGCATGGACAAGGGCAAGGGACTGATGCAGAACGCGATGGCACAAGGAAAATCGATG
GCCCAGGGCCTGATGGGCCCCGGCGGCAACGGCCTGCTGGAACAGGGCAAGGCCCTGGCCGGCACGGGGA
TGCAACTGGCGAAAAGCGGCCAGGCCGCGCTGCAGAAGGCGCAACAGGTCAAGGCCGCCGTCGGCGGCGA
CACCGGCGCCATGGCCCAGCTGGCCAGCAACGTGGTGCCCGGTGCAGCGCCCACGCTCAAGGCCGCCAGC
GCCCTCAAGCAACTGCCGAGCCTGCCCAAGCTCAGCGCTCCGGTGAACCCGGCCAAGCTGAACCATGAGG
TGCTGGCATGA