SecReT6
Protein ID: 108806035
SecReT6 ID135
T6SS typei1
Gene symbol-
Locus tagYPA_0037
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]53179..53676 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ1CC16
KEGG IDypa:YPA_0037
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.60E-57, Aligned region: 7..160
Protein Sequence: 165 a.a.     [Download]
>gi|108806035|ref|YP_649951.1| hypothetical protein YPA_0037 [Yersinia pestis Antiqua]
MSKNKQSSVAPKERINIKYVPNTGDQVAEIELPLNLLVVGDLKGVREETSIEERQVVSVNKNNFNSVMNE
ANISLSFNVPNRLEGDGEEDMPVALSIKGLDDFSPDNVAKKVPELKKILELREALVALKGPLGNIPAFRS
RLQDLLGNEDMREQLLKELDILNQK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|108805998|ref|NC_008150.1|:53179-53676 Yersinia pestis Antiqua chromosome, complete genome
ATGAGTAAAAATAAGCAAAGCAGTGTTGCCCCAAAAGAAAGGATTAACATCAAGTATGTGCCGAATACTG
GCGACCAGGTTGCAGAAATTGAATTACCGCTGAATCTGCTGGTTGTGGGTGATCTTAAAGGCGTGCGTGA
AGAGACTTCAATTGAAGAGCGTCAGGTTGTTTCGGTCAATAAGAATAACTTCAACTCAGTCATGAACGAA
GCAAATATCAGTCTGAGTTTCAATGTGCCTAATCGCCTTGAAGGTGATGGGGAAGAAGACATGCCGGTCG
CCTTGTCGATCAAGGGTCTTGATGATTTCTCGCCTGACAATGTGGCGAAAAAAGTTCCAGAGCTCAAAAA
AATTCTGGAACTACGGGAAGCGTTAGTGGCATTGAAAGGGCCATTGGGGAATATCCCAGCTTTCCGCTCT
CGTCTACAGGATTTGCTTGGCAATGAAGATATGCGCGAGCAGTTGCTGAAAGAATTGGACATTCTTAATC
AAAAATAA