SecReT6
Protein ID: 108806038
SecReT6 ID135
T6SS typei1
Gene symbol-
Locus tagYPA_0040
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]55672..56898 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ1CC13
KEGG IDypa:YPA_0040
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.70E-123, Aligned region: 3..354
Protein Sequence: 408 a.a.     [Download]
>gi|108806038|ref|YP_649954.1| hypothetical protein YPA_0040 [Yersinia pestis Antiqua]
MSFEKYFRDELDYLRQLGRDAAIERPHLAAFLSEQGSDPDVERLLEGFAFLTGNLREKIDDQFPELTHGL
LNMLWPNYLRPIPSMTIIEYTPDESVVTEATLVKRGSQVMSIPIAQNGQRSAFINSNAHAGPQCTFTLCR
DVWLFPMSIREISANSSNEQGILSIHFAAKAELNLQDLQLDKLRFYLGEDNYTSTQLYFWINHYFERAEL
VVNGITIPMPDFDFNPVGFERDDALLPYPKNAYMGYRILQEYFCFPEGFLFFDVNGVVDFPPHLNASEFS
LNLYFSQALPPEVKVRSTTLRMNCTPAVNLFQHDSEAIDLDGTQTEYPLCVSYHNPDHYDIFSVDRVDSW
LSEKGVPKGRGRALNPKTWTSALLLFYLSPVFCRTHSACFQANALCIVIMDIFYNVTL
 
Nucleotide Sequence: 1227 bp     [Download]
>gi|108805998|ref|NC_008150.1|:55672-56898 Yersinia pestis Antiqua chromosome, complete genome
ATGTCGTTCGAAAAGTATTTCAGGGACGAGCTGGACTACCTCCGGCAATTAGGACGCGATGCCGCAATAG
AACGGCCTCATCTCGCTGCATTTTTATCTGAGCAAGGTTCTGATCCGGATGTTGAACGTTTGCTGGAAGG
CTTTGCTTTTCTAACGGGCAACCTGCGTGAAAAAATCGATGATCAATTCCCTGAATTGACTCATGGTTTA
CTGAATATGTTGTGGCCGAACTACTTACGGCCAATACCGAGCATGACCATCATCGAGTACACACCGGATG
AAAGTGTGGTCACCGAGGCGACGCTGGTGAAACGGGGTAGCCAAGTGATGAGTATCCCCATCGCACAAAA
TGGTCAGCGCAGCGCGTTTATCAACAGTAATGCTCATGCCGGGCCACAATGTACTTTTACGTTGTGCCGT
GATGTGTGGTTGTTCCCCATGTCCATCCGGGAGATCTCGGCGAACAGCAGTAACGAACAAGGCATTTTGA
GTATTCACTTTGCCGCCAAAGCGGAATTGAACTTACAAGACCTGCAATTGGATAAATTGCGCTTTTATCT
GGGCGAAGACAACTACACCAGCACACAACTCTATTTCTGGATTAACCACTATTTCGAACGCGCTGAACTG
GTTGTCAACGGGATAACCATCCCGATGCCTGATTTTGACTTTAACCCAGTGGGCTTTGAACGCGATGATG
CCCTCTTGCCGTACCCGAAAAACGCCTATATGGGTTACCGGATCCTGCAAGAATATTTTTGCTTCCCCGA
AGGCTTTTTGTTCTTTGATGTCAATGGTGTGGTCGATTTTCCGCCGCACTTGAATGCCAGTGAATTCTCT
CTGAATTTGTATTTCTCTCAGGCATTGCCGCCTGAAGTGAAAGTCCGCTCCACCACACTGCGGATGAATT
GCACACCTGCGGTGAACCTGTTCCAACATGACAGTGAAGCGATTGATCTTGATGGAACCCAGACGGAATA
TCCGCTCTGTGTCAGCTACCATAATCCGGATCACTACGACATCTTTTCAGTTGATCGGGTTGACAGTTGG
CTCAGTGAAAAAGGTGTTCCTAAGGGGCGCGGCCGTGCACTGAACCCCAAAACTTGGACATCTGCTTTAC
TGCTTTTCTACCTGAGTCCGGTATTCTGCCGGACTCATTCCGCCTGTTTTCAGGCTAATGCGCTCTGTAT
TGTAATAATGGATATATTCTACAATGTCACGCTTTAA