SecReT6
Protein ID: 108806756
SecReT6 ID137
T6SS typei2
Gene symbol-
Locus tagYPA_0759
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]870258..870758 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ1C9Z5
KEGG IDypa:YPA_0759
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.90E-56, Aligned region: 7..159
Protein Sequence: 166 a.a.     [Download]
>gi|108806756|ref|YP_650672.1| hypothetical protein YPA_0759 [Yersinia pestis Antiqua]
MSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEQRPLSEREKLNINKNNFNSVLAE
FQPSLKLAVPDTLAGDNTDTAVALTFREMKDFEPESVARQIPQLRALLAMRNLLRDLKSNLLDNATFRRE
LENILKDDALSDELRAELAALAPKEG
 
Nucleotide Sequence: 501 bp     [Download]
>gi|108805998|ref|NC_008150.1|:870258-870758 Yersinia pestis Antiqua chromosome, complete genome
ATGTCCTCTTCAAGCTTCCAAAATGAGATACCTAAAGCACGCATTAACATCAAATTAGACCTGCATACTG
GCGGGGCGCAAAAGAAAGTCGAACTGCCTTTGAAGTTGTTGGTGATGGGCGATTACAGCAACGGTCAGGA
GCAGCGCCCGCTGTCTGAACGTGAAAAACTCAATATCAATAAAAATAATTTTAACAGTGTGCTGGCTGAA
TTCCAACCGAGCCTGAAACTCGCTGTACCGGACACGCTGGCCGGGGATAACACCGATACAGCCGTCGCTT
TGACCTTCCGCGAGATGAAAGATTTCGAACCGGAAAGCGTCGCCCGTCAAATCCCGCAACTGCGTGCCTT
GCTGGCCATGCGCAACCTGCTGCGAGACCTCAAATCCAATCTGCTGGACAACGCCACCTTCCGCCGTGAG
CTGGAAAATATCCTCAAAGACGATGCCTTGAGCGATGAACTGCGCGCTGAACTGGCGGCCCTGGCACCAA
AAGAGGGTTAA