SecReT6
Protein ID: 108806757
SecReT6 ID137
T6SS typei2
Gene symbol-
Locus tagYPA_0760
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]870807..872351 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ1C9Z4
KEGG IDypa:YPA_0760
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.80E-177, Aligned region: 14..51
DUF877 [PF05943], Evalue: 2.80E-177, Aligned region: 90..510
Protein Sequence: 514 a.a.     [Download]
>gi|108806757|ref|YP_650673.1| hypothetical protein YPA_0760 [Yersinia pestis Antiqua]
MSVQENRAQGTATTVLKNSPAAQGVYAALFEKINLSPVSSLAGIEAFQNNDALAEATTDERVTAAVSVFL
DLLKQSAKKVEKLDKTLLDGHIAALDDQISRQLDAVMHHPDFQRVESTWRGVKSLIDQTDFRQNVRIELL
DISKDHLVQDFEDAPEISQSGLYAQTYIQEYDTPGGEPIAAAISNYEFDRSPQDIALLRNISKVAAAAHM
PFIGSVGPAFFGKENMEEVAAIKDIGNYFDRAEYIKWKAFRDSDDSRYIGLTMPRVLGRLPYGPDTVPVR
SFNYVEQVKGPDHERYLWTNASFAFAANMVKSFIKNGWCVQIRGPQAGGAVTNLPIHLYDLGTGNQVKIP
SEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAH
YLKLIQRENIGTTKDRRLLELELNNWVRGLVTEMTDPGDDLQASHPLRDAKVTVEDIEDNPGFFRVKLYA
VPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|108805998|ref|NC_008150.1|:870807-872351 Yersinia pestis Antiqua chromosome, complete genome
ATGTCTGTACAGGAAAACCGTGCGCAGGGTACTGCGACGACCGTATTAAAGAATAGCCCTGCGGCACAAG
GGGTTTACGCCGCCTTGTTTGAAAAAATCAACCTGAGCCCGGTCTCCTCACTGGCCGGTATCGAGGCGTT
CCAGAACAACGATGCGCTGGCGGAAGCCACCACCGATGAGCGCGTTACCGCCGCCGTCAGTGTCTTTTTA
GACCTGCTGAAGCAGTCGGCGAAGAAAGTAGAAAAACTGGATAAAACCCTGCTGGACGGCCATATTGCCG
CACTGGATGACCAAATCAGCCGCCAGTTGGACGCGGTAATGCACCACCCCGATTTCCAGCGGGTGGAATC
GACCTGGCGTGGTGTGAAGTCGCTGATCGATCAGACCGATTTCCGCCAGAACGTGCGCATCGAGCTGCTG
GATATCAGTAAAGATCATCTGGTGCAGGATTTTGAAGATGCCCCGGAAATCTCACAAAGCGGTTTATACG
CCCAGACCTATATTCAGGAATACGACACCCCCGGCGGCGAACCGATTGCCGCGGCTATCTCCAACTACGA
GTTCGACCGCAGCCCGCAAGATATCGCCTTATTGCGCAATATCTCCAAAGTGGCGGCTGCAGCCCATATG
CCGTTTATCGGCTCAGTGGGTCCGGCGTTCTTTGGTAAAGAGAACATGGAAGAAGTGGCGGCGATTAAAG
ATATCGGCAACTACTTTGACCGCGCTGAATACATCAAATGGAAAGCTTTCCGCGACTCGGATGATTCCCG
CTATATCGGCCTGACCATGCCGCGCGTGCTGGGGCGTTTGCCTTATGGGCCAGACACCGTGCCGGTGCGC
AGCTTTAACTACGTAGAGCAGGTGAAAGGGCCGGATCATGAGCGTTATCTGTGGACCAACGCTTCGTTTG
CCTTTGCTGCCAACATGGTGAAAAGCTTCATTAAAAATGGCTGGTGTGTGCAGATCCGTGGCCCGCAGGC
CGGTGGTGCGGTCACCAACTTACCGATCCACCTGTACGATCTGGGTACCGGTAATCAGGTCAAAATTCCG
TCAGAGGTGATGATCCCGGAAACCCGCGAGTTCGAGTTTGCCAATCTGGGCTTTATCCCGCTGTCGTACT
ACAAAAACCGCGATTACTCGTGCTTCTTCTCGGCCAACTCGGCGCAGAAACCGGCGCTGTATGACACCGC
GGATGCCACGGCCAACAGCCGCATCAACGCCCGTCTGCCGTATATCTTCCTGCTGTCGCGCATTGCCCAT
TATCTGAAACTGATCCAGCGCGAGAACATCGGCACCACCAAAGATCGCCGTCTGCTGGAGCTAGAGCTGA
ACAACTGGGTGCGCGGGCTGGTGACGGAAATGACTGATCCGGGTGATGATTTGCAGGCGTCCCATCCCCT
GCGTGATGCCAAAGTGACGGTCGAAGATATCGAAGACAACCCCGGCTTCTTCCGCGTCAAGCTGTATGCG
GTACCGCATTTCCAGGTGGAAGGGATGGACGTCAATCTGTCATTGGTTTCCCAAATGCCGAAGGCTAAGG
CATAA