SecReT6
Protein ID: 108806774
SecReT6 ID137
T6SS typei2
Gene symbol-
Locus tagYPA_0777
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]895212..896498 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ1C9X7
KEGG IDypa:YPA_0777
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.00E-20, Aligned region: 69..126
ImpA-rel_N [PF06812], Evalue: 1.00E-20, Aligned region: 157..182
ImpA-rel_N [PF06812], Evalue: 1.00E-20, Aligned region: 302..318
ImpA-rel_N [PF06812], Evalue: 1.00E-20, Aligned region: 354..364
Protein Sequence: 428 a.a.     [Download]
>gi|108806774|ref|YP_650690.1| hypothetical protein YPA_0777 [Yersinia pestis Antiqua]
MATLTTLLTACAAEPEPLLQQARQQVALWERWLQPVTPDKHTGEDPGYDDHFQQMREEVNKLSGADTTLT
CELAEKLFTTHGKDVRVATYYVWARLHRDGEAGLADGLSLLAGLITRFGEGLHPLRTTSRKTALEWLAGS
RMRDSLSLYPEVDKADFERIVGALALIEQRLSLWDEGVRPQLGGLYTALENRLAQSGGLNAVVPQNSSGS
SSAGSLNPANTASPALRPVQSGRDLLDQTKTLAKYLRNQPQGWLSGHHLIKSVRWDTVHQSPPLDVNGRT
RLVPPRPEYRVQLKRLYLQQNWLALLEQAESIFAEGVNHFWLDVQWYLHQALSKAGAPFDGWASCITQDL
RLLLTRLPGLEGLCWSDGTPFADEVTLGWINQQVLESVSGWGSEPAAVSSGEDGILLLEPEALAQADSEG
IEAALNWL
 
Nucleotide Sequence: 1287 bp     [Download]
>gi|108805998|ref|NC_008150.1|:895212-896498 Yersinia pestis Antiqua chromosome, complete genome
ATGGCGACGTTAACTACCTTGCTCACCGCTTGTGCCGCAGAGCCTGAGCCACTTTTACAGCAGGCCAGAC
AACAGGTTGCGCTCTGGGAACGTTGGTTGCAACCGGTGACACCCGATAAGCATACCGGTGAAGACCCCGG
TTACGATGACCACTTCCAACAGATGCGTGAAGAGGTCAATAAGCTCTCGGGTGCCGATACCACGCTGACC
TGCGAGCTGGCTGAAAAGCTGTTCACCACACACGGCAAGGATGTGCGGGTGGCAACCTATTACGTCTGGG
CGCGGTTGCACCGTGACGGCGAGGCCGGGCTGGCGGATGGCCTTTCCCTGCTGGCCGGGCTGATCACGCG
CTTTGGTGAGGGCCTGCATCCGCTGCGTACAACCAGCCGGAAAACCGCGTTGGAGTGGCTGGCCGGCTCC
CGGATGCGCGACAGCTTGTCACTTTACCCGGAAGTGGATAAAGCCGATTTTGAGCGTATCGTGGGCGCAC
TGGCCCTTATCGAACAGAGGCTCAGTCTCTGGGACGAAGGCGTCCGGCCGCAACTGGGCGGGTTGTATAC
CGCCCTGGAAAACCGCCTCGCGCAATCTGGTGGGCTAAATGCCGTGGTGCCGCAAAACAGCAGCGGGTCA
TCATCGGCAGGCAGCTTGAACCCAGCCAACACGGCGTCACCGGCGTTGCGGCCAGTGCAATCGGGACGTG
ACCTGCTCGATCAGACCAAAACGCTGGCAAAATACCTGCGCAACCAGCCGCAGGGCTGGCTCTCCGGGCA
TCATCTTATCAAAAGCGTGCGCTGGGATACGGTACATCAGTCACCGCCATTAGATGTGAACGGACGGACC
CGGCTGGTACCGCCGCGCCCGGAATATCGCGTACAACTCAAGCGCCTTTATCTGCAACAAAACTGGCTGG
CGTTGCTGGAACAGGCCGAATCGATATTTGCCGAAGGGGTTAACCATTTCTGGCTCGATGTGCAGTGGTA
TCTGCATCAGGCCCTCAGCAAAGCGGGGGCCCCATTCGATGGCTGGGCGAGCTGTATCACGCAGGATTTA
CGGTTATTACTGACCCGGCTGCCGGGGCTGGAAGGGCTATGCTGGAGTGACGGCACGCCATTTGCCGATG
AGGTGACGCTGGGGTGGATAAACCAGCAGGTACTGGAGTCGGTCTCGGGCTGGGGCAGCGAGCCGGCCGC
CGTTTCATCCGGTGAGGATGGCATTCTGTTGCTGGAGCCAGAAGCTTTGGCTCAGGCGGACAGCGAAGGA
ATTGAAGCGGCGCTTAACTGGTTGTAG