SecReT6
Protein ID: 108806780
SecReT6 ID137
T6SS typei2
Gene symbol-
Locus tagYPA_0783
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]901268..901948 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ1C9X1
KEGG IDypa:YPA_0783
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.40E-39, Aligned region: 64..219
Protein Sequence: 226 a.a.     [Download]
>gi|108806780|ref|YP_650696.1| hypothetical protein YPA_0783 [Yersinia pestis Antiqua]
MTRRCQTIYLNILPWRWATTVGWLHSNIKKETDVLTTVWKNKTCTSKHKSWAAWKNKICIPALVLLLSGC
GLTQAVTDSTVSATKSLFYKQIKVLHLDFTAREALNTDAHEANSSSEPVMVRVYQLRDDKTFLKTVYQQL
ASDGEAALKDDLLASRSVVVKPGGAVTLDMPMEKETQFVAVVALFRHPDMAKDHWRLILTLDDLHPDKPR
TLELGNNSLTLRTEKK
 
Nucleotide Sequence: 681 bp     [Download]
>gi|108805998|ref|NC_008150.1|:901268-901948 Yersinia pestis Antiqua chromosome, complete genome
ATGACGCGACGCTGTCAGACGATATACCTGAATATTTTACCGTGGCGCTGGGCCACTACCGTGGGCTGGC
TCCACAGCAACATCAAGAAGGAAACCGACGTGTTAACTACCGTTTGGAAAAATAAAACCTGTACTTCGAA
ACATAAAAGCTGGGCCGCCTGGAAAAATAAAATCTGCATCCCCGCACTGGTCTTGTTGCTCAGTGGCTGC
GGGCTGACGCAAGCCGTGACCGATAGCACCGTGTCGGCCACAAAATCACTGTTTTATAAGCAGATAAAGG
TGCTGCATCTGGACTTTACCGCCCGTGAAGCCCTGAATACCGATGCGCACGAGGCGAACTCGTCATCGGA
GCCGGTAATGGTGCGGGTTTATCAGTTACGTGATGATAAAACCTTCCTCAAAACGGTGTATCAACAACTG
GCAAGCGACGGGGAGGCGGCGCTTAAAGATGACCTGCTGGCCAGCCGCAGTGTGGTGGTGAAACCGGGCG
GGGCGGTAACACTGGATATGCCGATGGAAAAAGAGACCCAGTTTGTGGCAGTGGTGGCGCTGTTCCGTCA
TCCGGATATGGCCAAAGACCACTGGCGTCTGATACTCACGCTGGACGACCTGCATCCCGATAAGCCCCGT
ACCCTTGAGTTGGGTAATAACAGCCTGACCCTGCGGACGGAGAAAAAATAA