SecReT6
Protein ID: 108806782
SecReT6 ID137
T6SS typei2
Gene symbol-
Locus tagYPA_0785
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]902425..903792 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ1C9W9
KEGG IDypa:YPA_0785
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.20E-50, Aligned region: 116..150
DUF3702 [PF12486], Evalue: 3.20E-50, Aligned region: 303..448
ImpA-rel_N [PF06812], Evalue: 7.80E-20, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 7.80E-20, Aligned region: 231..244
Protein Sequence: 455 a.a.     [Download]
>gi|108806782|ref|YP_650698.1| hypothetical protein YPA_0785 [Yersinia pestis Antiqua]
MAGNTERLLKTGGDPRALADFTALRGELNKLAHPARPDVDWVRVEQLCLALFRQNGVELQTAVDFTLART
HTVGLAGLCEGLELLAGLVCHQWRGLWPPQTHARVALLAWLSDRLQQVWRTMTLCYGDLAQVYRAERALE
QLCTQLQTLELKHLCKLDGVRLMLHNAAQRLESTEAVSGLAKPRGASEPPESLRFASVPVSEPLVYIISE
PAPPPVQVVLPASPPRWKAGHGFAAGLSLMAVLMAGSFVIWQSVSSDPVRETLLATASPLPIPLSANSIA
ELKKQASDVEWARLAEPVLQASAMQLDQLTQLPPLWAQARGDALLSQAQQLWPTNQEVKRLNALWQQQRA
AGAAPLVELKHYALAQDRLRQLAERLNSLDEKKRGYMTVSELKSAVFAIQQPLAQAVPLEELLRQYQEQL
ESGQTPSSALRQQIDSRFSQLLNRYALLVVPPGVQ
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|108805998|ref|NC_008150.1|:902425-903792 Yersinia pestis Antiqua chromosome, complete genome
ATGGCAGGTAATACCGAGCGTCTGCTGAAAACCGGTGGCGATCCGCGCGCACTGGCGGATTTCACCGCAC
TGCGGGGTGAATTAAATAAACTGGCCCACCCGGCCCGCCCGGATGTTGATTGGGTGCGAGTCGAGCAGCT
TTGTTTGGCGCTGTTTCGCCAGAACGGCGTTGAGTTACAGACTGCCGTTGATTTTACCCTGGCACGAACG
CACACCGTTGGGTTGGCGGGCTTATGTGAAGGGCTGGAACTGTTGGCGGGGTTGGTCTGCCATCAATGGC
GTGGGTTATGGCCACCGCAAACGCATGCCCGGGTGGCGTTACTGGCCTGGTTGAGCGACCGGCTGCAGCA
AGTGTGGCGCACCATGACGCTGTGCTACGGTGACCTGGCGCAGGTGTACCGGGCAGAGCGGGCGCTGGAA
CAGTTGTGTACGCAGTTGCAAACGCTGGAGCTCAAACATTTGTGCAAGCTGGACGGGGTTCGTTTGATGC
TGCATAACGCGGCGCAGCGGTTGGAAAGTACCGAGGCCGTGTCTGGCCTTGCGAAACCACGGGGTGCCTC
TGAACCGCCCGAGTCGCTGCGATTTGCCTCTGTCCCGGTCAGTGAACCACTGGTGTATATTATCAGCGAA
CCGGCCCCGCCACCTGTTCAGGTGGTTTTACCTGCCTCACCTCCGCGCTGGAAGGCGGGCCACGGTTTTG
CCGCGGGGTTATCGTTGATGGCGGTACTGATGGCCGGCAGTTTCGTTATCTGGCAGTCGGTATCATCGGA
TCCCGTGAGGGAAACATTGCTGGCCACTGCCAGTCCTTTGCCGATACCGCTGAGTGCTAACTCAATAGCT
GAACTGAAAAAACAGGCTTCAGATGTTGAGTGGGCACGTCTGGCGGAACCGGTGTTGCAAGCCAGTGCGA
TGCAGTTAGATCAACTAACACAGTTACCGCCGTTATGGGCGCAGGCTCGGGGGGATGCCTTGCTATCTCA
GGCGCAACAACTGTGGCCGACCAATCAAGAGGTCAAACGACTGAATGCGTTGTGGCAGCAACAGCGAGCA
GCCGGTGCTGCGCCCTTGGTAGAGTTGAAACACTATGCATTGGCGCAAGACCGTTTGCGGCAACTGGCAG
AACGACTGAATAGTCTGGATGAGAAAAAACGCGGATATATGACGGTCTCCGAACTGAAATCTGCCGTCTT
TGCTATCCAACAGCCGCTGGCACAGGCCGTGCCACTGGAAGAACTGCTGCGGCAATATCAGGAACAATTA
GAATCAGGGCAAACTCCATCCTCAGCACTGCGTCAACAGATTGACAGCCGGTTTAGTCAATTGCTGAACC
GCTATGCGTTGCTGGTCGTACCTCCTGGCGTTCAGTAA