SecReT6
Protein ID: 108808114
SecReT6 ID138
T6SS typei3
Gene symbol-
Locus tagYPA_2120
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]2372745..2375591 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ1C637
KEGG IDypa:YPA_2120
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.00E-76, Aligned region: 29..347
Phage_base_V [PF04717], Evalue: 4.20E-24, Aligned region: 387..480
Collagen [PF01391], Evalue: 6.10E-11, Aligned region: 767..805
Collagen [PF01391], Evalue: 6.10E-11, Aligned region: 857..880
Protein Sequence: 948 a.a.     [Download]
>gi|108808114|ref|YP_652030.1| hypothetical protein YPA_2120 [Yersinia pestis Antiqua]
MSRTINLSSPAMPYLLGEPALVLSKLEGEEAFSTLYSYTITAKTPANPLIPWQAASNVDLKSLIGKEMTI
EMELDGNGLGDVRSVGKGTREITGLVERARYIGRDANQAIFEITIKPWFYLANLTSDFKIYQNKNVVDII
EEVFSDYNFPFEKRLATTYPILDFQVQYGETDFNFLQRLMEEWGIYWFFEHQDHKQKLILVDHVGAHKRS
FSTAYHAIEYLSDEPKAGEEYITQFQTQETLTSGTWVTNDYDFTKSRADILAMDSKPRKTSFNDLEIYHW
PGDYDQPDIGEHLSRVRIEERGALGSRAVGSGQLRGIVCGANFELKGFPVDKANREYMIISSRLTVAEVD
QLSGGEDAFSCESSFTVQPTTKIYRHPQVTPKPKTNGPQNAIIVGPPGEEIWTDEYGRVKVRFVWDRYGT
NSESDSCWLRVSQAWAGNSFGGIYIPRIGQEVIVDCINGDPDRPMVMGSLYNNVTRPPWDLPANATQSGM
VSRTVGGGLTNYNGVRFEDKSGLEQYWEQAERDMSRLTKNNETQIIGADSVLNVGANRSEVVGANYNQDV
LGTSMLAIGAASMLQVGLARSVVVGGAHSLNVVLANATNVGGANMTNVGGFNGLAVGGAHQTAVGGAATL
AAGGPIAIGAGGELILSGDIVKIVGKSKVIIQGGEVHINSDDCCGRKTGNGGGAFGAFASLAGLLPLAGA
IALPLPLPLLPIVVPPVTSPPDPTVPPDPTLPPDPTLPPDPTLPPDPTLPPETTAPPETTAPPRNHGTAG
NHGTARNNGTARDNGTAGNHGTAGNNGTARDNGTARDNGTARNNGTAGNNGTAGNNGTAGNNGTAGNNGT
AGNHGTARDNGTARDNGTAGNNGTARNNGTAGNNGTAGNNGTAGNNGTAGNNGTARNNGTAGNNGTARNN
GTAGNNGTARNNGTARNNGTAGTDANTARDADATALIL
 
Nucleotide Sequence: 2847 bp     [Download]
>gi|108805998|ref|NC_008150.1|:c2375591-2372745 Yersinia pestis Antiqua chromosome, complete genome
ATGTCAAGGACAATAAATTTGAGCAGCCCGGCTATGCCTTATCTATTGGGTGAGCCTGCGCTGGTACTGT
CTAAGTTGGAAGGCGAGGAAGCCTTTTCGACTTTATATTCTTATACTATTACGGCAAAGACACCGGCTAA
CCCATTAATTCCTTGGCAAGCGGCTTCAAATGTCGATCTCAAATCCTTAATTGGTAAAGAGATGACGATT
GAAATGGAACTGGACGGCAACGGCCTGGGTGATGTGAGAAGTGTAGGTAAAGGCACGCGTGAAATTACGG
GGCTGGTTGAGAGAGCCAGATACATTGGTCGAGATGCCAATCAGGCCATATTTGAGATCACTATTAAGCC
TTGGTTCTACCTGGCTAATTTAACCTCTGACTTTAAAATTTATCAAAATAAAAATGTCGTTGATATTATA
GAGGAAGTGTTCTCAGACTATAATTTTCCGTTTGAGAAACGGTTGGCTACAACCTATCCGATATTAGATT
TTCAGGTTCAGTACGGTGAAACCGACTTTAATTTCCTTCAGCGTTTGATGGAAGAGTGGGGTATTTACTG
GTTCTTTGAGCATCAGGATCATAAACAAAAATTAATTCTTGTGGATCATGTCGGTGCGCATAAACGCTCG
TTCAGTACCGCCTACCATGCCATTGAGTACTTGTCGGATGAGCCTAAAGCGGGCGAAGAGTACATCACAC
AATTCCAGACTCAGGAAACCTTGACGAGTGGGACCTGGGTCACCAACGATTATGACTTCACGAAATCCCG
TGCCGATATTCTGGCAATGGACAGTAAACCGCGTAAAACCAGCTTTAACGATCTCGAGATTTATCACTGG
CCAGGGGATTATGATCAGCCAGATATTGGTGAGCACCTTTCACGCGTGCGTATCGAAGAACGTGGTGCTC
TGGGTTCGCGGGCGGTCGGTTCTGGTCAACTGCGCGGGATAGTTTGTGGTGCTAACTTCGAGCTGAAAGG
GTTCCCCGTTGATAAAGCGAATCGGGAATACATGATTATCTCCAGCCGTTTGACGGTGGCTGAAGTTGAT
CAACTGTCTGGCGGTGAGGATGCGTTTAGTTGCGAGAGTTCTTTCACGGTTCAGCCGACGACCAAAATCT
ATCGTCACCCACAGGTGACACCAAAACCGAAAACCAATGGGCCGCAAAACGCCATTATTGTGGGGCCACC
GGGTGAAGAGATTTGGACCGATGAATATGGCCGCGTAAAAGTGCGTTTCGTTTGGGATCGCTATGGCACA
AACAGCGAGTCAGACTCTTGCTGGCTACGTGTTAGCCAGGCTTGGGCAGGGAACAGCTTTGGTGGGATCT
ATATTCCACGCATTGGTCAGGAAGTCATTGTTGACTGTATTAACGGCGATCCTGACCGGCCAATGGTGAT
GGGCAGCCTTTATAATAACGTGACGCGTCCCCCTTGGGACCTGCCTGCCAATGCGACGCAAAGTGGCATG
GTCAGTCGTACCGTTGGCGGCGGGTTAACCAACTATAACGGCGTTCGTTTTGAAGATAAATCGGGGCTGG
AGCAGTACTGGGAACAGGCCGAGCGCGATATGTCGCGTTTGACTAAAAATAATGAAACGCAAATTATCGG
TGCCGATTCTGTCCTGAATGTAGGGGCCAACCGAAGTGAAGTTGTCGGGGCCAATTATAACCAAGATGTT
CTTGGCACATCAATGTTAGCCATCGGTGCAGCCTCTATGCTACAGGTGGGATTGGCGCGTAGCGTTGTGG
TTGGCGGAGCACATTCACTGAATGTGGTTTTGGCGAATGCCACCAATGTGGGTGGCGCTAACATGACCAA
CGTAGGGGGGTTTAATGGCCTTGCGGTGGGGGGAGCCCATCAGACAGCTGTAGGCGGTGCTGCGACACTG
GCTGCCGGCGGCCCTATTGCTATTGGGGCGGGTGGTGAGCTTATCCTCAGTGGGGATATCGTAAAAATTG
TTGGTAAAAGTAAGGTTATTATTCAGGGCGGTGAAGTTCACATTAACTCTGATGATTGTTGTGGTCGTAA
AACGGGCAATGGCGGCGGGGCATTCGGTGCCTTTGCGAGCCTGGCAGGTTTATTGCCGCTGGCGGGTGCT
ATTGCCTTACCGCTACCGTTACCCTTGTTGCCAATAGTGGTGCCACCAGTGACATCGCCACCGGATCCAA
CAGTGCCACCGGATCCGACATTGCCACCGGATCCGACATTGCCACCAGATCCAACGTTGCCACCAGATCC
AACGTTACCGCCGGAAACCACGGCACCGCCGGAAACCACGGCACCGCCGCGAAACCACGGCACCGCCGGA
AACCACGGCACCGCCAGAAACAACGGCACCGCCAGAGACAACGGCACCGCCGGAAACCACGGCACCGCCG
GAAACAACGGCACCGCCAGAGACAACGGCACCGCCAGAGACAACGGCACCGCCAGAAACAACGGCACCGC
CGGAAACAACGGCACCGCCGGAAACAACGGCACCGCCGGAAACAACGGCACCGCCGGAAACAACGGCACC
GCCGGAAACCACGGCACCGCCAGAGACAACGGCACCGCCAGAGACAACGGCACCGCCGGAAACAACGGCA
CCGCCAGAAACAACGGCACCGCCGGAAACAACGGCACCGCCGGAAACAACGGCACCGCCGGAAACAACGG
CACCGCCGGAAACAACGGCACCGCCAGAAACAACGGCACCGCCGGAAACAACGGCACCGCCAGAAACAAC
GGCACCGCCGGAAACAACGGCACCGCCAGAAACAACGGCACCGCCAGAAACAACGGCACCGCCGGAACCG
ACGCGAACACCGCCAGGGACGCAGACGCCACCGCCTTGATTTTATAG