SecReT6
Protein ID: 108808116
SecReT6 ID138
T6SS typei3
Gene symbol-
Locus tagYPA_2122
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]2379721..2380557 [-]
Productputative OmpA family protein
NoteTssL
UniProt IDQ1C635
KEGG IDypa:YPA_2122
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.90E-18, Aligned region: 18..111
OmpA [PF00691], Evalue: 1.70E-16, Aligned region: 172..270
Protein Sequence: 278 a.a.     [Download]
>gi|108808116|ref|YP_652032.1| putative OmpA family protein [Yersinia pestis Antiqua]
MGRWWRYKWITFHPSLTYADGLEVLLRILGLGFEGRYSIIEDGDRQLTKIRQGLLTLLQSTRDTIPPALS
PHGLIAHQNRRRRGIFVPVRVSMLLCGFLIVATFIGCKYFLSVPESDLLKRMGALQRVVVTPPVAAPKLR
LSILLKDEIAKQLVSVDETSNNSKVIFKGDSMFMVGSDNVRPEMIDVIKRVAQEVHRVKGAILIVGHTDS
MPINKPGFPNNQVLSEKRAANVARYMEQAGIPTDKIRFEGKGETQPVSSNDDATGRSQNRRVEIFVNY
 
Nucleotide Sequence: 837 bp     [Download]
>gi|108805998|ref|NC_008150.1|:c2380557-2379721 Yersinia pestis Antiqua chromosome, complete genome
TTGGGCCGTTGGTGGAGATATAAGTGGATCACTTTTCATCCGTCGTTGACATATGCGGATGGTTTAGAGG
TTTTGCTGCGCATTTTAGGGCTCGGTTTTGAGGGGCGCTACAGCATTATCGAAGATGGTGATCGGCAATT
AACTAAAATACGCCAAGGGTTGCTGACGCTGCTCCAAAGTACCCGAGACACGATCCCACCGGCACTTTCT
CCGCATGGGTTGATCGCACATCAAAACAGAAGACGGCGGGGCATTTTTGTTCCGGTGCGCGTATCCATGC
TGTTGTGTGGTTTCCTCATTGTCGCGACCTTTATTGGATGTAAATACTTTCTCTCGGTACCGGAAAGTGA
CTTGCTAAAAAGAATGGGAGCATTGCAACGTGTGGTTGTGACGCCACCCGTTGCCGCACCAAAACTTCGA
CTGTCTATTTTATTAAAAGATGAGATAGCGAAGCAGTTAGTCAGTGTTGATGAAACGAGCAACAACAGCA
AAGTCATCTTTAAAGGCGACTCTATGTTTATGGTCGGCTCGGATAACGTCAGACCTGAAATGATTGACGT
AATTAAACGCGTCGCGCAGGAAGTGCATCGCGTTAAAGGGGCAATCCTCATCGTCGGGCATACAGACTCT
ATGCCGATTAATAAACCCGGCTTCCCTAATAACCAGGTACTTTCCGAAAAACGCGCGGCCAATGTTGCAC
GCTATATGGAGCAGGCCGGTATTCCAACCGACAAAATTCGGTTTGAGGGCAAGGGGGAAACGCAACCGGT
TAGCAGCAATGACGATGCGACAGGACGTTCGCAAAACCGCCGCGTAGAAATTTTTGTTAATTATTGA