SecReT6
Protein ID: 108808119
SecReT6 ID138
T6SS typei3
Gene symbol-
Locus tagYPA_2125
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]2382388..2383056 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ1C632
KEGG IDypa:YPA_2125
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-29, Aligned region: 86..198
Protein Sequence: 222 a.a.     [Download]
>gi|108808119|ref|YP_652035.1| hypothetical protein YPA_2125 [Yersinia pestis Antiqua]
MSDSSDLNLGGSMPPFDRSRNVDESPQALGRFLLDEPMTSPDSTQDNTAFTREAPHSGAAQQYDTTLLRG
ESVQQRVAKVLASSTPLLEAAQPLLRALSEMPAHIGDVSQVHILKQSLKNEITLFSVVCDEADISWKKMA
IVRYCLCTALDEAAHTMSWGMMAGWSQSNLLNHFEGDNDGGNKFFLLVGRLSMSPHEYAVTNGAIVIHTQ
RLKSDPGGNLLS
 
Nucleotide Sequence: 669 bp     [Download]
>gi|108805998|ref|NC_008150.1|:c2383056-2382388 Yersinia pestis Antiqua chromosome, complete genome
ATGAGTGACAGCAGTGATTTGAACCTTGGAGGCTCAATGCCTCCTTTTGATAGAAGCAGAAATGTGGATG
AGAGTCCGCAGGCATTAGGCCGGTTCTTGCTTGATGAGCCAATGACATCCCCAGATAGCACTCAGGATAA
TACGGCCTTCACTAGAGAGGCCCCTCATTCTGGTGCGGCACAGCAATATGACACGACCCTCTTACGGGGT
GAAAGTGTGCAACAGCGTGTCGCTAAAGTACTCGCATCTTCAACGCCATTATTGGAAGCGGCACAGCCAC
TATTACGTGCCTTGAGCGAGATGCCCGCGCATATTGGGGATGTTTCACAGGTTCATATATTAAAACAAAG
CCTTAAAAATGAGATCACCCTCTTTAGTGTGGTGTGTGATGAAGCGGATATCTCATGGAAAAAAATGGCT
ATCGTCCGCTATTGCCTGTGTACTGCGTTGGATGAAGCCGCTCACACGATGTCGTGGGGAATGATGGCAG
GTTGGTCACAAAGCAACCTGTTGAACCATTTTGAAGGCGATAATGACGGCGGGAATAAGTTTTTCTTATT
GGTCGGCCGTCTCTCTATGAGCCCGCATGAATATGCTGTAACGAACGGTGCAATAGTGATCCACACCCAA
CGCCTGAAATCAGATCCAGGGGGTAATCTGCTCTCCTGA