SecReT6
Protein ID: 108808120
SecReT6 ID138
T6SS typei3
Gene symbol-
Locus tagYPA_2126
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]2383053..2384402 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ1C631
KEGG IDypa:YPA_2126
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.50E-144, Aligned region: 19..447
Protein Sequence: 449 a.a.     [Download]
>gi|108808120|ref|YP_652036.1| hypothetical protein YPA_2126 [Yersinia pestis Antiqua]
MRTNKVVWSEGLFLRPQLFQQQERYLEYYAHKRAATITPFFWGFAQYEIDREALSYGKLVLRSGKGVLPD
GTPFDIPGHAELPEPLTITPEHLGKLIYLAVPLRLDNSDETIFDEHDMSSLARFYAYEAALNDTNAIRQG
PKPVQLSRLRLRLVSEGEMTESWIGLPLTKVRAIQPDGSVLLHTEDYIPPVTGYAASSLLSEWLTHLNGL
VKMRAEMLANRLSNSDGKASASAEIVDYLLLQIFNKYEPILDHLRHIPELPPITLYQELAKFSGELSTFI
RTKTRRPRPAPGYDHAKLYASIRPLVDEVHELLNQILVRAGQMIPLETKGNGVWSASVLPNELRSFSNLV
LAVHAQLPMDVLQHQFSVQTKISAPQQLHELVRSHLPGLELQRLPVPPRQIPYSAGYVYFELIKNGPFWD
KVSNAGAIALHVAGDFPALKMELWGIRDS
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|108805998|ref|NC_008150.1|:c2384402-2383053 Yersinia pestis Antiqua chromosome, complete genome
GTGAGAACTAACAAAGTCGTTTGGAGTGAGGGGCTTTTTCTTCGCCCACAACTTTTTCAACAGCAAGAGC
GCTATCTTGAATATTACGCCCATAAGCGAGCTGCAACGATAACCCCATTCTTTTGGGGATTTGCGCAATA
TGAAATTGATAGAGAAGCACTCTCGTATGGCAAATTAGTATTGCGATCTGGGAAGGGCGTGTTACCCGAC
GGTACACCATTTGATATTCCCGGCCATGCTGAATTGCCTGAACCGCTCACTATCACCCCAGAACATCTGG
GTAAGTTGATCTATCTGGCGGTACCACTGCGCCTGGATAACAGTGATGAAACCATTTTTGATGAGCACGA
TATGAGCTCATTGGCACGTTTTTACGCCTATGAAGCTGCGCTCAACGATACCAATGCCATTCGGCAAGGG
CCGAAGCCGGTACAACTGTCAAGATTACGTCTCAGATTAGTCTCAGAAGGTGAGATGACAGAATCATGGA
TTGGGCTGCCATTAACCAAAGTCAGAGCGATTCAGCCTGATGGGAGTGTCTTGCTACACACCGAAGACTA
TATTCCTCCGGTGACGGGTTATGCCGCAAGTTCATTGCTGTCTGAATGGCTAACCCATCTTAATGGTTTG
GTTAAAATGCGCGCAGAGATGTTGGCCAATCGCTTGTCAAACAGTGATGGGAAAGCGAGCGCCAGCGCAG
AAATTGTCGATTATTTGTTACTGCAAATTTTTAATAAATATGAGCCGATTCTCGATCATTTAAGGCATAT
TCCTGAATTACCGCCTATTACGCTTTATCAGGAATTGGCTAAGTTCTCGGGGGAATTATCTACCTTTATC
CGGACCAAAACCCGCCGACCCCGCCCGGCACCTGGCTATGATCATGCGAAGCTCTATGCGTCTATTCGTC
CGTTGGTTGACGAAGTTCATGAACTACTGAACCAGATCTTGGTGCGTGCTGGGCAGATGATACCGCTGGA
GACGAAAGGCAATGGCGTTTGGTCTGCCTCCGTACTGCCTAATGAATTACGCTCGTTTTCAAATCTGGTC
CTTGCCGTTCATGCGCAATTACCGATGGATGTGCTACAGCATCAATTTTCAGTACAAACAAAAATCAGCG
CACCTCAGCAATTGCATGAACTGGTGCGATCGCATTTGCCAGGGTTGGAACTACAGCGTTTGCCGGTACC
GCCCAGACAAATTCCGTATAGCGCAGGGTACGTTTATTTTGAATTGATAAAAAATGGCCCCTTCTGGGAC
AAAGTTTCCAATGCTGGTGCCATTGCCCTGCATGTGGCGGGTGATTTCCCTGCCTTGAAAATGGAGCTCT
GGGGGATTAGAGATTCATGA