SecReT6
Protein ID: 108808122
SecReT6 ID138
T6SS typei3
Gene symbol-
Locus tagYPA_2128
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]2385219..2385788 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ1C629
KEGG IDypa:YPA_2128
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.30E-43, Aligned region: 34..164
Protein Sequence: 189 a.a.     [Download]
>gi|108808122|ref|YP_652038.1| hypothetical protein YPA_2128 [Yersinia pestis Antiqua]
MCLRIHMGSSYTRCFALSDIYKSAREDIMAQDMFIKIDGIEGESLDANHKNEIQVLAWNWDVAQHSNMHS
GSGGGSGKASVSDFCFAHYIDKASPNLLSYCLLGKHIKNVQFVLRKAGGDPLEYLTIKFTDVIITRVDMA
GSLEDETRPREEIRFSFTKMTQDYVMQNAEGHKSGVISANYDVKANMHS
 
Nucleotide Sequence: 570 bp     [Download]
>gi|108805998|ref|NC_008150.1|:c2385788-2385219 Yersinia pestis Antiqua chromosome, complete genome
ATGTGCCTCCGTATTCATATGGGGTCTTCCTACACTCGATGTTTTGCATTGAGTGACATTTATAAAAGTG
CTAGAGAGGATATTATGGCGCAAGATATGTTTATCAAAATTGATGGTATTGAAGGTGAGTCTTTGGATGC
CAATCACAAAAACGAAATCCAGGTATTAGCTTGGAACTGGGATGTTGCTCAACACTCGAATATGCACAGC
GGTTCAGGTGGCGGTTCAGGTAAAGCCTCTGTTTCAGATTTTTGCTTCGCACATTATATCGATAAAGCTA
GCCCGAACTTATTGAGCTATTGCTTGTTGGGTAAGCACATTAAAAATGTTCAGTTCGTACTGCGTAAAGC
TGGTGGCGATCCGCTGGAATATCTGACAATTAAATTTACCGATGTCATCATTACTCGTGTTGATATGGCG
GGTTCTTTGGAAGATGAAACGCGTCCACGTGAAGAAATTCGTTTCTCATTCACTAAGATGACTCAGGACT
ATGTTATGCAGAATGCTGAAGGCCATAAGTCTGGCGTTATTTCTGCTAACTACGATGTTAAAGCTAACAT
GCACAGCTAA