SecReT6
Protein ID: 108808133
SecReT6 ID138
T6SS typei3
Gene symbol-
Locus tagYPA_2139
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]2399903..2400928 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ1C618
KEGG IDypa:YPA_2139
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.20E-88, Aligned region: 22..321
Protein Sequence: 341 a.a.     [Download]
>gi|108808133|ref|YP_652049.1| hypothetical protein YPA_2139 [Yersinia pestis Antiqua]
MLPDESVHQEKHANLDAWYQESQPWNAGFISMMRANAARNPTLPAPGKAPLPEQEAFRIGQSAHMTFSPR
EISHAVMRDGKMDLQLFGLGIWGPNGAMPLQMTELAYTRAELHDHTMTDFVDLFHHRALSQLYRAWFVSQ
DTASLDRQSDEKFSFYVGSLAGLDPQELNDTELPVHARLASSAHLIREARNPEGLVGALQYYFDVPVRMV
EYAEQWIFLEESDQTQLGDGAGAMLLGDGAILGNTVLDRQHKFQLILGPLSLQQYLRFSLWGQDLPVLRE
WVRNFVGFEYAWEVQLLLSADEVPMATLDGGHQLGYTSWLARSDTTLDVGGMSFEPEMHHD
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|108805998|ref|NC_008150.1|:2399903-2400928 Yersinia pestis Antiqua chromosome, complete genome
ATGTTACCCGATGAATCCGTTCACCAGGAAAAACATGCCAATCTGGACGCCTGGTATCAGGAGTCTCAGC
CATGGAACGCCGGTTTTATCAGCATGATGCGGGCGAATGCCGCCCGCAACCCTACCCTGCCAGCGCCAGG
AAAAGCGCCCTTGCCTGAACAGGAAGCCTTCCGCATCGGGCAAAGTGCGCACATGACGTTCTCTCCGCGT
GAGATATCTCACGCGGTCATGAGAGACGGGAAAATGGATCTGCAACTTTTTGGCTTAGGGATTTGGGGGC
CAAATGGTGCGATGCCGCTTCAGATGACCGAACTGGCCTATACCCGTGCCGAGTTGCATGATCATACGAT
GACGGATTTCGTCGACCTTTTTCATCACCGCGCATTATCACAGCTTTATCGGGCGTGGTTTGTCTCTCAG
GATACCGCCTCGCTAGATCGGCAGAGTGATGAAAAATTCTCCTTCTATGTCGGTAGTCTCGCCGGGCTGG
ATCCTCAAGAACTTAATGATACCGAACTCCCGGTTCATGCCCGGTTAGCCTCCTCTGCCCATTTGATTCG
TGAAGCGCGCAACCCCGAAGGGCTCGTGGGCGCATTGCAGTACTACTTTGACGTCCCCGTGCGGATGGTG
GAGTACGCCGAGCAGTGGATCTTTCTGGAAGAAAGCGACCAGACACAATTGGGTGATGGTGCAGGCGCGA
TGCTCTTGGGCGACGGTGCTATTTTGGGCAATACCGTTTTGGATCGGCAGCATAAATTTCAACTGATCCT
CGGCCCCCTCAGCCTGCAACAGTACCTGCGCTTTAGCCTCTGGGGACAAGACTTACCGGTATTGCGAGAG
TGGGTACGTAACTTTGTTGGGTTCGAATACGCCTGGGAAGTCCAGTTGTTGTTAAGCGCCGATGAGGTTC
CCATGGCAACACTCGATGGCGGACATCAATTGGGATACACCTCTTGGTTAGCCCGCAGTGATACCACCCT
TGATGTCGGTGGGATGAGTTTTGAGCCTGAAATGCATCACGATTAA