SecReT6
Protein ID: 108808134
SecReT6 ID138
T6SS typei3
Gene symbol-
Locus tagYPA_2140
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]2401027..2402208 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ1C617
KEGG IDypa:YPA_2140
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.60E-18, Aligned region: 62..121
ImpA-rel_N [PF06812], Evalue: 3.60E-18, Aligned region: 203..215
Protein Sequence: 393 a.a.     [Download]
>gi|108808134|ref|YP_652050.1| hypothetical protein YPA_2140 [Yersinia pestis Antiqua]
MSEQSIAERAGYYQSMMQPIPGDFPCGKNLEYDPAFIMLQTKLQPKQAAEYGNFVEVAEPNNWTDIERKC
LELLNNSRDIRLFIILMRCRMRQVGVGALQEGLEAILWCLDTWPDQLHPQLFDEGEFEPLMRGNAFAELE
DIDGFIADFRNQQLPKAAGVQLSIKEFEKAHSVPREEGALDEGTLEAVKQEWQNRSDHTILSLQHAYALL
QGLATRLNNSLGEDTPDFVRMTSVLRHFDAAITPIAPIVVPIPEVVELYPVATAMLASTEMPVTAEVQTV
AETQMAIPIEAPQQRQAVVTPSPQLQPLQLQSAQLQPVPIQSQPVPVQQQGIQNRADALARLIEVREWFT
AMEPSSPVIALLAFSEKTIGKSFGELLQFIPQELISKLNEGQE
 
Nucleotide Sequence: 1182 bp     [Download]
>gi|108805998|ref|NC_008150.1|:2401027-2402208 Yersinia pestis Antiqua chromosome, complete genome
ATGAGTGAACAGAGTATCGCTGAACGTGCCGGTTATTATCAAAGCATGATGCAGCCCATTCCAGGTGACT
TTCCTTGTGGCAAAAATCTGGAATATGACCCGGCATTTATTATGCTACAGACAAAATTGCAACCTAAGCA
GGCCGCTGAATACGGCAATTTTGTTGAGGTCGCTGAACCCAATAACTGGACAGATATCGAGCGTAAATGC
CTTGAACTCCTGAATAATTCTCGGGATATTCGGCTGTTTATTATTCTGATGCGCTGCCGGATGCGTCAGG
TCGGTGTGGGCGCGTTGCAAGAAGGGCTGGAAGCCATACTTTGGTGCCTCGACACTTGGCCTGATCAGCT
ACATCCTCAGTTGTTTGATGAAGGGGAATTTGAACCTTTAATGCGCGGTAATGCTTTTGCTGAACTGGAA
GATATTGATGGTTTTATCGCCGACTTCCGTAATCAGCAGTTACCCAAAGCCGCTGGCGTGCAACTTTCCA
TCAAAGAGTTTGAAAAAGCACACTCCGTTCCTCGAGAAGAAGGGGCATTGGACGAAGGGACTCTGGAAGC
CGTTAAGCAAGAGTGGCAGAACCGATCAGATCACACCATTCTCTCACTCCAGCACGCTTATGCCTTGTTG
CAAGGATTAGCCACGCGCCTCAACAACTCCCTCGGTGAAGACACACCTGATTTTGTCAGAATGACCTCAG
TGTTACGCCACTTTGATGCCGCGATAACCCCGATAGCGCCTATCGTGGTGCCGATCCCAGAAGTTGTCGA
GCTCTATCCAGTCGCCACAGCGATGCTAGCAAGCACAGAAATGCCAGTGACCGCCGAGGTACAGACGGTT
GCAGAGACACAAATGGCCATACCCATTGAAGCTCCCCAACAGCGTCAAGCGGTGGTAACCCCATCCCCAC
AGTTGCAGCCGTTACAGTTGCAATCGGCACAGTTGCAACCTGTACCGATACAGTCACAGCCGGTGCCTGT
CCAGCAGCAAGGGATCCAAAACAGGGCTGATGCATTAGCCCGGCTTATAGAGGTGCGAGAGTGGTTTACC
GCCATGGAACCGAGTAGCCCGGTCATTGCCTTACTGGCTTTTTCAGAAAAAACTATCGGCAAAAGCTTCG
GCGAATTGCTGCAGTTCATTCCTCAGGAACTGATTTCGAAACTCAATGAAGGACAGGAGTAA