SecReT6
Protein ID: 108809377
SecReT6 ID139
T6SS typeN/A
Gene symbol-
Locus tagYPA_3386
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]3772839..3775088 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ1C2H4
KEGG IDypa:YPA_3386
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-72, Aligned region: 58..356
Phage_GPD [PF05954], Evalue: 1.20E-72, Aligned region: 563..563
Phage_GPD [PF05954], Evalue: 1.20E-72, Aligned region: 636..679
Phage_base_V [PF04717], Evalue: 6.80E-24, Aligned region: 338..372
Phage_base_V [PF04717], Evalue: 6.80E-24, Aligned region: 396..489
Gp5_C [PF06715], Evalue: 0.00023, Aligned region: 530..551
Gp5_C [PF06715], Evalue: 0.00023, Aligned region: 557..575
Gp5_C [PF06715], Evalue: 0.00023, Aligned region: 589..607
Gp5_C [PF06715], Evalue: 0.00023, Aligned region: 636..649
Gp5_C [PF06715], Evalue: 0.00023, Aligned region: 663..673
Gp5_C [PF06715], Evalue: 0.00023, Aligned region: 715..725
Protein Sequence: 749 a.a.     [Download]
>gi|108809377|ref|YP_653293.1| hypothetical protein YPA_3386 [Yersinia pestis Antiqua]
MFADSNKAKVKERSAVNSASTGTAAISAAINAPSGLQFKLTAAGLPPQTFAVVDFSLNEAFSSPFVLHVG
LASADPAVDFSAVLDEDATLSIWREGILQRSITGMIASFEQGNTGFHQTRYSMVIRPALWRTSLRRNSRI
FQLESVEAIISTLLKENGINDFAFGFRHSHPAREFCVQYQESDFDFIQRLTAEEGIFYYFEFSTGKNTVV
YADDVGSLPKGASLPYNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPKWAAEFSEQARELQNQR
PDYEHFDFPGRFKDEQHGKDFTRYRLEALRNDANKGQGESNEFTLQPGQLFSLSAHPRDDLNHAWQIVSI
QHTGKQMQALEQESGDQGTVLFNQFSFIPPTQTWRPTPLPKPVTDGPQIAMVVGPPSEEIYCDEYGRIRL
QFQWDRYGQSNDQSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDFLHGDPDQPIVTGRTYHANNLPPSAL
PGAKTQMALQSKTHKGEGYNELRFEDQDGKQELSMRAQRDMNTTVLNDRSTTVSGNHTETVTKDQAVTVS
GNQTMDITQDQTITVTGTQRIDVTQDRIIDVTQDRIIDVTAEQQTTVKADDRLLISGKQKTKIDLDQEYE
VVGSQKKTIGANQTLKVGGYQKNTLEGYKKSKIGGDNTTTVGGHDKLTVGDTITITAGTSITLQCGASSI
VMDEAGNIKITGVNITSAASTTHTIKAKTVTSCGDTENIVEGGILKLNP
 
Nucleotide Sequence: 2250 bp     [Download]
>gi|108805998|ref|NC_008150.1|:3772839-3775088 Yersinia pestis Antiqua chromosome, complete genome
ATGTTTGCTGACAGTAATAAAGCCAAAGTAAAAGAACGTAGTGCAGTTAACTCGGCTTCAACGGGGACAG
CCGCTATTTCTGCAGCAATTAACGCACCTTCCGGGCTACAATTTAAGCTGACCGCTGCCGGTTTACCGCC
TCAGACATTTGCCGTCGTCGATTTTTCATTAAACGAGGCGTTCTCCTCACCTTTTGTTTTACATGTTGGC
TTGGCCAGTGCCGATCCTGCGGTGGATTTTTCTGCGGTATTGGATGAAGACGCGACGTTGTCTATCTGGC
GCGAAGGTATTTTACAGCGCAGTATTACTGGCATGATTGCCAGCTTTGAACAGGGCAATACCGGGTTTCA
CCAGACCCGCTACAGTATGGTGATCCGCCCCGCGCTGTGGCGCACTTCTTTGCGCCGCAACTCACGAATT
TTCCAGTTGGAATCGGTTGAGGCCATCATTTCTACGCTGTTGAAAGAGAATGGCATTAATGATTTTGCCT
TCGGTTTCCGTCATTCACATCCAGCACGTGAGTTCTGTGTGCAATATCAAGAGTCGGATTTTGATTTTAT
CCAGCGCCTGACAGCAGAAGAGGGCATTTTCTACTACTTCGAATTCAGCACGGGCAAAAACACCGTGGTC
TATGCCGATGATGTTGGCTCCCTGCCGAAGGGGGCGTCACTGCCGTATAACCCGAATGTGGCGGCACAGG
CGCAGGAACTGAGCATCACCACCTTTACCCGCAGCGCGCAAGTACGCCCGGCGATGGTACAGCTAAAAGA
CTACACCTTCAAAAATCCCAAATGGGCGGCTGAGTTCAGTGAACAAGCGCGCGAGTTACAGAATCAGAGG
CCGGATTACGAGCATTTTGACTTCCCTGGGCGTTTCAAAGATGAGCAACATGGCAAGGATTTTACCCGTT
ACCGGTTGGAGGCACTGCGCAACGATGCGAATAAGGGGCAGGGGGAAAGTAACGAATTTACCTTGCAGCC
GGGGCAACTCTTTAGCCTGAGTGCCCACCCGCGTGACGATTTAAATCATGCCTGGCAGATCGTCAGCATT
CAGCATACCGGTAAACAGATGCAGGCACTGGAGCAAGAATCTGGCGATCAGGGCACCGTATTGTTTAACC
AGTTCAGCTTTATTCCACCGACGCAAACCTGGCGGCCAACGCCGCTGCCAAAACCAGTCACTGATGGCCC
ACAGATCGCGATGGTCGTGGGGCCCCCGAGCGAAGAAATTTACTGCGACGAGTATGGCCGCATCCGGCTG
CAATTCCAGTGGGACCGCTATGGTCAAAGTAACGATCAAAGTTCATGTTGGATCCGCGTTACCCAGCCGT
GGGCTGGCCAAGGCTGGGGCATGTTGGCGATCCCGCGTATCGGCCAGGAAGTGGTGGTAGATTTTCTGCA
CGGTGACCCGGACCAACCGATTGTCACCGGGCGCACTTATCATGCTAATAACCTTCCCCCTTCAGCATTG
CCTGGGGCGAAAACGCAGATGGCGCTACAGTCGAAAACCCATAAAGGCGAAGGCTATAACGAATTGCGTT
TTGAGGATCAAGACGGCAAGCAAGAGCTGTCGATGCGGGCACAGAGGGACATGAATACCACGGTGTTGAA
TGACCGTTCGACCACGGTTTCAGGCAATCACACCGAAACGGTGACCAAAGATCAAGCGGTGACGGTTTCG
GGTAATCAGACCATGGATATCACCCAAGACCAAACCATTACTGTCACTGGGACACAACGCATTGATGTGA
CTCAAGATCGCATCATTGATGTGACTCAAGATCGCATCATTGATGTGACAGCAGAACAACAAACGACGGT
AAAAGCAGATGATCGGTTACTGATATCCGGAAAACAGAAAACCAAGATAGATCTGGATCAGGAATATGAG
GTTGTCGGCTCACAAAAAAAGACTATTGGGGCTAACCAAACACTGAAGGTGGGCGGATATCAAAAAAATA
CCCTCGAGGGTTATAAAAAATCCAAGATTGGCGGCGATAATACCACCACCGTTGGGGGGCACGATAAATT
AACCGTCGGTGACACAATCACTATCACCGCCGGCACCAGTATTACGCTGCAATGTGGTGCCTCCAGTATT
GTTATGGATGAAGCCGGTAATATAAAAATCACCGGGGTTAATATCACCTCTGCGGCATCGACGACACATA
CGATAAAAGCTAAAACAGTGACATCCTGCGGTGATACGGAAAATATCGTGGAAGGTGGCATTCTAAAATT
AAATCCTTAA