SecReT6
Protein ID: 108809387
SecReT6 ID139
T6SS typeN/A
Gene symbol-
Locus tagYPA_3396
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]3787840..3788583 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ1C2G4
KEGG IDypa:YPA_3396
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.00E-73, Aligned region: 4..247
Protein Sequence: 247 a.a.     [Download]
>gi|108809387|ref|YP_653303.1| hypothetical protein YPA_3396 [Yersinia pestis Antiqua]
MHRGHGREYTSFESFHHQIEHSQEKTALYYRLRVKNSLFRKGFEHYISFVRSDESKLVLAEENVSVSLTC
TNRELPLSLRVGDINQLSTDSPSFATFRNITRPSVPLYPVLDGGLHWSLLSNMSLNYMSLLDKDALKQIL
HTYDFPSLHNRQSARASQKKLDAIQRIETQPIDRLFRGLPVRGLQTTLWLEQGAFSSEGELYLFSTVLAR
FFSLYASVNAFHLLKVINLDNQECYEWPVQTGQHALM
 
Nucleotide Sequence: 744 bp     [Download]
>gi|108805998|ref|NC_008150.1|:3787840-3788583 Yersinia pestis Antiqua chromosome, complete genome
GTGCACCGGGGTCATGGCCGGGAGTACACCTCGTTTGAGAGCTTCCACCATCAGATCGAACACTCGCAAG
AAAAGACCGCACTTTATTACCGCCTACGTGTGAAAAATTCATTATTCCGTAAGGGATTCGAACACTACAT
TTCCTTTGTTCGCAGTGATGAATCGAAGCTGGTGCTTGCTGAAGAGAATGTCTCGGTCAGCCTGACGTGC
ACCAACCGTGAGTTGCCGCTGTCGTTGCGCGTTGGTGATATCAATCAACTCAGCACAGACAGCCCTTCAT
TCGCGACGTTCCGCAATATTACCCGTCCTTCCGTGCCGTTGTATCCGGTGCTGGATGGGGGCCTGCATTG
GTCATTGCTCTCCAATATGTCGTTGAACTACATGTCCTTACTGGATAAGGACGCGTTGAAGCAAATTCTG
CATACCTATGATTTCCCAAGCCTGCATAACCGGCAATCAGCCAGGGCATCGCAAAAGAAACTGGACGCTA
TCCAACGTATTGAAACACAACCGATTGACCGGTTGTTTCGTGGCTTACCTGTCAGAGGGCTACAAACCAC
GCTATGGCTGGAGCAAGGCGCTTTTAGCTCTGAAGGCGAGCTTTATCTCTTCAGCACGGTATTAGCTCGC
TTCTTCTCACTGTATGCCAGCGTCAATGCGTTTCATCTTTTAAAAGTCATCAATCTTGATAATCAGGAAT
GTTACGAATGGCCGGTACAGACAGGTCAACATGCACTGATGTAA