SecReT6
Protein ID: 108809390
SecReT6 ID139
T6SS typeN/A
Gene symbol-
Locus tagYPA_3399
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]3791077..3791622 [+]
Productputative lipoprotein
NoteTssJ
UniProt IDQ1C2G1
KEGG IDypa:YPA_3399
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.60E-36, Aligned region: 17..174
Protein Sequence: 181 a.a.     [Download]
>gi|108809390|ref|YP_653306.1| putative lipoprotein [Yersinia pestis Antiqua]
MNNARGYLLTWALCVVFLLSGCSGAWEATKKVGKVVMDPDIPVGQATDQPSTVRLTLLSDPDTNPNEKGE
AVPTEIVVVYLSENSKLLAADYDQLSSDALEKTLGKNYIDHQEYTLLPDQFKALDPIKLEEKNSYLGVIA
HYADANRSEWKKIIKIKGIGHNYQVLVHVRSNDVDLRKEEE
 
Nucleotide Sequence: 546 bp     [Download]
>gi|108805998|ref|NC_008150.1|:3791077-3791622 Yersinia pestis Antiqua chromosome, complete genome
ATGAACAACGCCAGAGGCTATCTCCTGACGTGGGCATTATGTGTGGTGTTCCTGTTGTCTGGGTGCAGCG
GTGCATGGGAAGCCACTAAAAAGGTCGGCAAGGTGGTTATGGACCCTGATATTCCGGTGGGGCAGGCTAC
CGATCAACCCTCAACGGTCAGGCTAACATTGCTGTCCGATCCCGATACCAACCCTAATGAAAAAGGGGAA
GCGGTACCGACTGAGATAGTGGTGGTGTACCTAAGTGAAAACTCCAAGCTGCTGGCCGCGGATTATGATC
AGCTAAGCAGTGACGCGTTGGAGAAAACGCTGGGTAAGAATTACATCGATCATCAGGAATACACCTTACT
GCCCGATCAATTCAAGGCGCTGGACCCTATCAAGCTGGAAGAGAAAAACAGCTATCTGGGGGTGATTGCT
CACTATGCCGATGCCAACCGCAGTGAATGGAAGAAGATCATCAAAATAAAAGGGATCGGCCATAACTACC
AGGTTTTGGTCCATGTCAGATCAAACGATGTCGATCTAAGGAAAGAGGAAGAATAA