SecReT6
Protein ID: 108809391
SecReT6 ID139
T6SS typeN/A
Gene symbol-
Locus tagYPA_3400
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]3791625..3792971 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ1C2G0
KEGG IDypa:YPA_3400
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.40E-155, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|108809391|ref|YP_653307.1| hypothetical protein YPA_3400 [Yersinia pestis Antiqua]
MPTKNRVIWREGLFIKPQHFQQQQRHNDYQLQRRIIALQGYSYGFSSLILNQELLKLGRIGLTVASGNMA
DGTVFDIPYQDYSPKPLDVLNCNDAASRDIYLALPMLNDAINEVAGQQGQAPGTLRYREHSDDVRDLHTE
GGDVSQLVLAQLAPRLMQGSEDLSAYSVLPLCRVKEKRPDGSLILDEEFIPTCTTLSVSTQLKGFMDEVE
GTLVERAQLLAKRIGSPGQQGIADVAEFMMLQVFNRTQPLFTHLAHQAILHPEAFYHQLVQTCGELRTFT
DESRLAGTFPVYNHDNLTDSFQPLFLAMRQALSTVLTPRAISIQLHMQAHGIRVATINDSDLLRSADFVL
AVRAQIPQEQLRRQFVQQTKITSLEKIRDLVSVQLPGVPLVALSAAPRQLPYHSGYTYFMLDLQSPVWKE
IQQSNAIAFHVSGDFPDLDMQFWAIRSS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|108805998|ref|NC_008150.1|:3791625-3792971 Yersinia pestis Antiqua chromosome, complete genome
ATGCCAACCAAAAATCGAGTGATTTGGCGCGAAGGGCTGTTCATCAAACCGCAACATTTTCAACAACAGC
AACGGCATAACGACTACCAGTTACAACGCCGGATTATCGCTCTGCAAGGGTATAGCTATGGTTTCAGTTC
ACTGATCCTGAATCAGGAGTTATTGAAATTAGGGCGTATTGGCTTGACGGTCGCCAGTGGCAATATGGCT
GATGGCACGGTGTTTGATATCCCTTATCAAGACTATTCACCAAAGCCATTGGATGTACTGAATTGTAATG
ATGCGGCCAGCCGTGACATTTATCTGGCATTACCGATGCTAAACGATGCCATTAATGAGGTGGCAGGCCA
GCAGGGGCAAGCGCCGGGAACCCTTCGCTATCGTGAACATAGCGATGATGTCCGCGATTTACATACCGAA
GGGGGCGATGTCAGCCAGTTGGTACTGGCACAACTGGCACCGCGTTTGATGCAAGGCTCGGAAGACCTCA
GTGCTTACTCGGTCCTGCCGCTGTGTCGGGTCAAAGAGAAACGGCCTGACGGTTCGCTGATCTTGGATGA
AGAGTTCATTCCCACCTGCACCACGCTCAGTGTCTCCACGCAGTTAAAAGGCTTTATGGATGAAGTCGAA
GGGACATTGGTTGAACGCGCCCAACTACTGGCGAAACGTATTGGTTCTCCCGGTCAGCAGGGGATCGCGG
ATGTGGCTGAATTTATGATGTTGCAGGTCTTTAACCGGACACAGCCGCTCTTTACCCATTTGGCACATCA
GGCGATTCTGCATCCAGAAGCGTTTTACCATCAGTTGGTACAAACCTGCGGTGAACTGCGCACGTTTACC
GATGAATCACGCTTAGCGGGCACCTTCCCGGTTTATAACCACGATAACTTGACCGACAGTTTTCAGCCGT
TGTTTTTGGCGATGCGTCAGGCATTAAGCACCGTGCTCACACCGCGTGCCATCTCTATCCAGTTGCATAT
GCAGGCACACGGTATTCGCGTTGCGACCATTAATGATAGTGATCTATTGCGCAGTGCTGATTTTGTGCTG
GCGGTTCGGGCGCAAATACCTCAAGAACAATTGCGTCGGCAGTTTGTTCAGCAAACCAAAATCACCTCAC
TTGAGAAAATACGCGATTTGGTCAGTGTCCAACTGCCCGGCGTCCCGTTGGTGGCACTGTCCGCCGCACC
GCGCCAGCTCCCTTACCACTCGGGATACACCTACTTCATGCTGGATCTGCAAAGCCCTGTATGGAAAGAA
ATCCAGCAAAGCAATGCGATTGCCTTCCACGTCTCGGGTGATTTCCCTGATCTGGACATGCAATTCTGGG
CAATCAGGAGCAGCTAA