SecReT6
Protein ID: 108809398
SecReT6 ID139
T6SS typeN/A
Gene symbol-
Locus tagYPA_3407
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]3802913..3803695 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ1C2F3
KEGG IDypa:YPA_3407
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.20E-22, Aligned region: 41..101
Protein Sequence: 260 a.a.     [Download]
>gi|108809398|ref|YP_653314.1| hypothetical protein YPA_3407 [Yersinia pestis Antiqua]
MSDTPQHIIIKTGTDPRNRPEFNAIREEINKINHPARPEVNWGLIESLALTLFRTHGVDLQTAVYYTLAR
TQKNGLAGFTEGCELLAGMVVGQWDHLWPEQPQARSEILEWFNTRVSNQLRQHDFTRDDLRLVYRAERAL
QLLYDKLQQVELKRVPRIENLLYLMQNTAKKLESASDAAKAQQTAAPLKMPPMVYLSVPEAEPVRTAAAA
PEPAANIEVRSPPRRLNGGRCCGALVPVSCVVYWWRLRFTLPSSNRCNSK
 
Nucleotide Sequence: 783 bp     [Download]
>gi|108805998|ref|NC_008150.1|:3802913-3803695 Yersinia pestis Antiqua chromosome, complete genome
ATGAGTGACACCCCGCAACATATCATCATTAAAACCGGCACTGACCCACGGAACCGGCCGGAATTTAACG
CCATTCGTGAAGAGATCAACAAAATCAACCACCCGGCACGGCCAGAGGTCAACTGGGGTTTGATTGAATC
ACTGGCGCTGACCCTGTTCCGCACCCACGGCGTGGATTTGCAGACGGCGGTGTATTACACGCTGGCCCGC
ACCCAAAAAAATGGCCTGGCCGGTTTCACCGAGGGCTGCGAGTTGCTGGCCGGTATGGTAGTCGGCCAGT
GGGATCACCTGTGGCCGGAACAGCCGCAGGCACGCAGTGAAATACTGGAATGGTTCAATACCCGCGTCAG
CAATCAACTGCGTCAGCATGATTTTACCCGTGACGATCTGCGGCTGGTGTACCGCGCCGAGCGGGCCTTG
CAGTTGCTGTACGATAAATTGCAACAGGTTGAATTAAAACGGGTACCGCGCATTGAAAACTTGCTGTACC
TGATGCAGAACACCGCCAAAAAACTCGAATCGGCCAGTGATGCGGCGAAGGCTCAGCAAACCGCGGCCCC
GCTGAAAATGCCGCCTATGGTCTATCTCTCGGTACCCGAGGCCGAGCCTGTCCGGACGGCAGCGGCAGCC
CCTGAGCCTGCGGCCAATATTGAGGTGCGTTCGCCCCCCCGGCGACTAAACGGGGGGCGGTGCTGTGGGG
CTTTGGTGCCGGTGTCCTGTGTAGTTTACTGGTGGCGACTGCGGTTTACGTTACCCAGTTCAAACCGCTG
CAACAGCAAATGA