SecReT6
Protein ID: 108809399
SecReT6 ID139
T6SS typeN/A
Gene symbol-
Locus tagYPA_3408
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]3803602..3804225 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ1C2F2
KEGG IDypa:YPA_3408
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.10E-48, Aligned region: 24..39
DUF3702 [PF12486], Evalue: 2.10E-48, Aligned region: 54..201
Protein Sequence: 207 a.a.     [Download]
>gi|108809399|ref|YP_653315.1| hypothetical protein YPA_3408 [Yersinia pestis Antiqua]
MLWGFGAGVLCSLLVATAVYVTQFKPLQQQMTVLATQPESAALLWLNRPDVATYGEQLSTLENLSPLFVL
NTADQSVAMARQRWPSDPSQVAESQRWARLVEARIGLAGTDSSYFQLQQRLHALSEKLLEQERSRGSLTI
SYLKTAVYQMQTELNREIPLEELLRQLAVSADEHQPASPVLIKQIDDRWNALLSRYHHLTQQTNSAR
 
Nucleotide Sequence: 624 bp     [Download]
>gi|108805998|ref|NC_008150.1|:3803602-3804225 Yersinia pestis Antiqua chromosome, complete genome
GTGCTGTGGGGCTTTGGTGCCGGTGTCCTGTGTAGTTTACTGGTGGCGACTGCGGTTTACGTTACCCAGT
TCAAACCGCTGCAACAGCAAATGACGGTGCTGGCCACCCAACCGGAAAGCGCGGCATTGCTGTGGCTCAA
CCGCCCGGATGTCGCCACCTATGGTGAGCAACTGAGCACCCTGGAAAACCTCTCGCCCCTGTTTGTGCTC
AATACCGCCGACCAGTCGGTGGCGATGGCTCGTCAACGCTGGCCGTCCGATCCCAGTCAGGTGGCCGAAA
GCCAGCGCTGGGCGCGGTTGGTGGAGGCGCGTATCGGCCTGGCCGGTACCGACAGCAGCTATTTCCAGCT
CCAGCAGCGCTTGCATGCGCTGTCTGAAAAATTACTCGAACAGGAACGTTCTCGGGGCAGTCTGACCATC
TCCTATCTAAAAACAGCAGTTTACCAGATGCAGACCGAGCTGAACCGGGAGATACCGCTGGAGGAGTTAC
TGCGCCAGTTGGCGGTGTCCGCCGATGAACATCAACCGGCCTCGCCGGTCTTGATAAAACAAATTGATGA
CCGCTGGAATGCCTTACTCAGCCGTTATCACCACTTAACGCAGCAGACGAACTCTGCCCGTTAA