SecReT6
Protein ID: 108809400
SecReT6 ID139
T6SS typeN/A
Gene symbol-
Locus tagYPA_3409
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]3804247..3806649 [+]
Productputative Rhs accessory genetic element
NoteTssI
UniProt IDQ1C2F1
KEGG IDypa:YPA_3409
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-69, Aligned region: 194..491
Phage_GPD [PF05954], Evalue: 1.40E-69, Aligned region: 670..701
Phage_base_V [PF04717], Evalue: 1.90E-23, Aligned region: 531..623
Protein Sequence: 800 a.a.     [Download]
>gi|108809400|ref|YP_653316.1| putative Rhs accessory genetic element [Yersinia pestis Antiqua]
MFAHDKANNNKAADKTGTVTPTHIVSPEAAPTVSGAQMTEMAGGIGDAVGGTAGKRINQAAEVAKTALDA
KAKVLDGGVTPTNIVATGPAPTVSGAQMTEMAGGIGDAVGGTAGKRINQAAEVAKTALEAKAKVLDGGVT
PMNLAAGGAGAGLPDSAAAAISRLVKQPSGLQFTLTTASLPPQTFAVVDFTLSEMLSSPFVLNVGLASAD
PAVDFAAVLDEDATLFIWREGVLQRSITGMVASFEQGDTGFHQTRYSMVIRPALWRTSLRRNARIFQQAS
VEEIITTLLKENGINDFAFGFRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAGKNTVVYADDV
GSLPKGASLPYNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGELQNQRPDYEH
FDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRGDLNHAWQLLGIQHSGK
QMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGPPGEEIYCDEYGRIRLQFLWD
RYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDFLHGDPDQPIVTGRTYHANNIPPGSLPASKT
QMAFRSKTHKGEGYNEMRFEDAKGGEGLFMHAQKDMTTMVLNDRKTDVTQDHSEHIGQDQSVTVVRNQSN
TIQNDRRVEVTRDQQTEVGNDYQLVVKGEKKEFVTKIRYTEVHEDETLTVTKSIKIHAKQGDISISTPNA
GITITHDGAIVLQGKYIRLAADMIDLNPEE
 
Nucleotide Sequence: 2403 bp     [Download]
>gi|108805998|ref|NC_008150.1|:3804247-3806649 Yersinia pestis Antiqua chromosome, complete genome
ATGTTTGCTCATGATAAAGCTAATAATAATAAAGCCGCGGACAAGACCGGCACGGTGACGCCGACCCATA
TCGTCTCGCCGGAGGCCGCCCCAACCGTGAGTGGCGCTCAGATGACCGAGATGGCCGGGGGGATTGGGGA
TGCGGTGGGCGGCACTGCCGGTAAGCGCATCAATCAGGCCGCCGAGGTGGCAAAAACCGCCCTGGATGCC
AAAGCAAAAGTACTGGACGGCGGCGTCACGCCGACGAACATTGTGGCCACTGGCCCGGCCCCAACCGTGA
GTGGCGCTCAAATGACCGAGATGGCCGGGGGGATCGGGGATGCGGTGGGCGGTACTGCCGGTAAGCGCAT
TAATCAGGCCGCCGAGGTGGCTAAAACCGCCCTGGAGGCCAAAGCAAAAGTACTGGACGGCGGCGTCACG
CCGATGAATCTGGCCGCGGGCGGGGCCGGTGCGGGATTGCCGGACAGCGCCGCGGCGGCGATATCCCGCC
TGGTCAAACAGCCCTCCGGCCTGCAATTTACCCTGACGACGGCCAGTTTACCGCCCCAGACCTTTGCGGT
GGTGGATTTCACCCTGAGCGAGATGCTCTCCTCGCCGTTTGTGCTCAATGTCGGGCTGGCGAGTGCCGAT
CCGGCGGTGGATTTTGCGGCGGTATTGGATGAAGACGCCACGCTGTTTATCTGGCGCGAAGGGGTACTGC
AACGCAGCATCACCGGCATGGTCGCCAGCTTTGAACAGGGCGATACCGGTTTTCATCAGACCCGCTACAG
CATGGTGATCCGCCCGGCGCTGTGGCGCACCAGCCTGCGGCGCAATGCCCGCATCTTCCAGCAAGCCTCG
GTGGAAGAGATCATCACCACCCTGCTGAAAGAGAACGGCATCAACGATTTTGCTTTTGGTTTTCGCCACC
CGCACCCGGTGCGCGAGTTCTGCGTGCAATATCAGGAGTCCGATTTTGATTTTATCCAGCGCCTGACGGC
AGAAGAGGGGATTTTCTACTACTTCGAGTTCAGCGCCGGGAAAAATACCGTGGTGTATGCCGATGATGTT
GGCTCCCTGCCGAAAGGCGCGTCACTGCCCTATAACCCGAATGTGGCGGCGCAGGCGCAGGAACTGAGTA
TCACCACCTTCACCCGCAGTGCGCAGGTGCGCCCGGCGATGGTGCAACTGAAAGACTACACCTTTAAAAA
CCCGAACTGGGCCGCGGCCTTCAGCGAACAGTCGGGAGAACTGCAAAACCAGCGACCGGACTACGAGCAT
TTTGATTTTCCGGGGCGCTTCAAAGATGCCCAGCACGGGCAGGATTTTACCCGCTACCGGCTGGACGCGC
TGCGCAATGACGCCAATCTGGGGCAGGGGGCCAGCAATGATTTTACCCTCCAGCCGGGGCAGTTGTTCAG
CCTGTACAACCACCCGCGTGGTGATCTGAACCACGCCTGGCAGTTGCTCGGTATTCAGCACAGCGGCAAA
CAGATGCAGGCGCTGGAGCAGGCATCTGGCGATCAGGGCACGGTGCTGTTCAACCACTTCAGTTTTATTC
CGCACACCCAGACCTGGCGGCCGACGCCGTTGGCTAAACCGGCGATGGACGGCCCGCAGATCGCCATGGT
GGTGGGGCCGCCGGGGGAAGAGATTTACTGCGACGAATACGGCCGCATCCGCCTGCAATTTTTATGGGAT
CGCTACGGGCAGAGCAATGACAACAGCTCCTGTTGGATCCGGGTAACCCAGCCGTGGGCGGGCCAGGGCT
GGGGCATGCTGGCCATTCCGCGTATTGGTCAGGAAGTGGTGGTGGATTTTCTGCACGGCGATCCGGATCA
ACCGATTGTCACGGGGCGGACCTATCACGCCAACAACATCCCGCCGGGGTCGTTACCGGCCAGTAAAACC
CAGATGGCGTTCCGCTCAAAAACCCACAAAGGGGAAGGCTACAACGAAATGCGCTTCGAGGATGCCAAAG
GCGGCGAAGGGCTGTTTATGCATGCGCAGAAAGATATGACGACCATGGTGCTGAATGATCGCAAAACCGA
TGTGACTCAGGACCATTCAGAGCACATTGGGCAAGATCAGTCCGTGACGGTTGTGCGTAACCAAAGTAAT
ACGATCCAAAATGATCGCCGGGTAGAGGTGACTCGCGATCAACAAACCGAAGTGGGCAATGATTACCAGC
TAGTGGTGAAAGGTGAAAAGAAAGAGTTTGTGACGAAAATTCGTTACACCGAAGTGCATGAAGACGAAAC
GCTCACGGTGACGAAAAGTATTAAAATCCATGCCAAACAAGGTGATATCAGCATATCAACCCCGAATGCC
GGAATTACGATCACCCATGACGGTGCCATTGTTCTGCAAGGGAAATACATTCGTTTAGCGGCCGATATGA
TCGATCTTAATCCAGAGGAGTAG