SecReT6
Protein ID: 108809573
SecReT6 ID140
T6SS typeN/A
Gene symbol-
Locus tagYPA_3582
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]4011955..4013310 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ1C1X8
KEGG IDypa:YPA_3582
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-121, Aligned region: 19..446
Protein Sequence: 451 a.a.     [Download]
>gi|108809573|ref|YP_653489.1| hypothetical protein YPA_3582 [Yersinia pestis Antiqua]
MLPKQRVAWVEGMLMEPQHFQQQERYLEHLTEMRARSLSALAWGFHSLSINQGLLDQGKIALNQASGVFP
DGTPFHMAGDEPLPLPFDPGENCQGSVVCLSVLMDIPGNTYIDLKKSNQGSRFVALDAEVQDRNHGVAAE
GTPLIATLQLGQLQSKLTLRASVSDAESMLPVAYIKERTRDGRLILDDNFLPPMLDFRAIGWIDNAVTEL
LGLIVQRLESVYRPDVTLSVGGLSELLELLLLQTLSEYNLKISHVLMQKQVHPEQLFQLLLGLLGRLSTI
PGGEKPWSRQDLLYTHHEPHNGYFSLFAALRRALSLVIEAPAVALPFIERGDNIYLCQNDSQLRLEKLIF
TVSSKLPSETIRTYFPAQTKLGPVEKIVQLIDLQLPGARMIPMSSPPRYIPYYPNSVYFEVDHDDPMYKE
MMSGSAIALSIVGDFPELRFEVWGLRQGRLG
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|108805998|ref|NC_008150.1|:c4013310-4011955 Yersinia pestis Antiqua chromosome, complete genome
ATGCTGCCAAAACAACGTGTTGCTTGGGTGGAAGGGATGCTGATGGAACCCCAGCATTTTCAACAACAGG
AACGATATCTAGAACATTTAACTGAAATGCGGGCACGTAGCCTCAGCGCGCTGGCATGGGGCTTCCATAG
CCTAAGTATCAATCAAGGGCTGCTGGATCAGGGCAAGATCGCCCTCAATCAGGCCAGTGGTGTTTTCCCT
GACGGTACACCTTTTCATATGGCGGGTGATGAGCCATTACCGCTACCTTTTGATCCGGGGGAGAACTGCC
AAGGCAGTGTCGTGTGCCTTTCGGTCCTGATGGATATACCCGGCAATACCTATATTGATCTGAAGAAGAG
CAACCAAGGTAGCCGTTTCGTTGCGCTGGATGCTGAAGTTCAAGACAGAAACCATGGCGTCGCTGCTGAA
GGAACGCCATTGATCGCCACCCTTCAACTGGGGCAATTGCAATCCAAGCTCACCTTACGTGCCAGCGTCA
GTGATGCAGAATCGATGCTGCCCGTAGCCTATATCAAAGAGCGCACCCGCGATGGGCGTCTGATTCTGGA
TGATAACTTCCTGCCACCCATGTTGGATTTTCGCGCCATAGGGTGGATCGATAATGCGGTAACCGAATTG
CTAGGGTTGATCGTTCAGCGACTGGAATCGGTTTACCGGCCAGATGTGACGCTCTCAGTCGGTGGGTTAT
CGGAGTTACTGGAACTGCTATTACTGCAAACACTCAGTGAATATAACCTAAAGATTTCACATGTGTTGAT
GCAAAAACAGGTACACCCTGAGCAGTTGTTCCAATTATTGCTTGGGTTGTTGGGGCGTCTCAGTACTATC
CCTGGCGGAGAAAAACCGTGGTCGAGGCAGGATCTGCTCTATACGCATCATGAACCGCACAACGGGTATT
TCTCGCTGTTTGCCGCCTTACGGCGCGCACTCTCACTGGTGATCGAAGCACCGGCAGTGGCGCTACCGTT
TATCGAACGTGGCGACAATATTTACCTGTGCCAGAACGATTCACAACTGCGTCTGGAAAAACTGATCTTC
ACCGTCAGTTCCAAACTGCCTTCCGAGACCATTCGCACTTACTTCCCGGCGCAAACCAAACTGGGGCCGG
TGGAGAAAATTGTACAGTTGATCGACCTGCAATTGCCTGGCGCACGGATGATCCCGATGTCATCACCGCC
AAGATATATTCCTTATTACCCGAATAGCGTCTATTTCGAAGTTGACCATGATGATCCTATGTATAAAGAA
ATGATGTCTGGTTCAGCTATCGCACTCAGCATCGTGGGTGATTTCCCTGAGTTGCGTTTTGAAGTATGGG
GCTTGCGACAAGGAAGGCTCGGATGA