SecReT6
Protein ID: 108809574
SecReT6 ID140
T6SS typeN/A
Gene symbol-
Locus tagYPA_3583
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]4013430..4013921 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDQ1C1X7
KEGG IDypa:YPA_3583
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-17, Aligned region: 16..155
Protein Sequence: 163 a.a.     [Download]
>gi|108809574|ref|YP_653490.1| putative lipoprotein [Yersinia pestis Antiqua]
MRSLFRVLPIFILTGCVLLSGCSWFSSSSEAALQKRRIDLQVVAAPLINPGPNGQAQPLKVCIIELNKEG
WSPPGLYQGTLCSGISVGGEVVSVTEYILAPTEVRQYSRDVPFEQERWWAIAAEFQEMSNGKSLLTLKSD
ARADFNRVVLVDGKALSLKASTK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|108805998|ref|NC_008150.1|:c4013921-4013430 Yersinia pestis Antiqua chromosome, complete genome
ATGCGTAGCCTCTTTCGTGTGTTGCCTATTTTTATCCTGACAGGTTGCGTCCTGCTCAGCGGCTGTAGCT
GGTTTTCCTCATCCTCAGAAGCGGCGCTACAGAAACGGCGGATTGACTTGCAGGTTGTTGCGGCTCCTCT
CATCAATCCTGGGCCCAACGGTCAGGCACAGCCCTTGAAGGTATGCATTATTGAGCTGAATAAAGAGGGG
TGGTCACCCCCCGGTTTGTATCAGGGGACGCTCTGCAGTGGCATCAGTGTAGGAGGTGAAGTCGTCAGCG
TGACGGAATACATCCTTGCGCCGACAGAGGTGCGTCAATATTCCCGCGATGTTCCCTTTGAACAAGAGCG
CTGGTGGGCAATAGCGGCTGAGTTTCAGGAGATGAGTAACGGTAAAAGCCTATTAACGCTGAAATCTGAT
GCCCGTGCGGACTTCAACCGTGTGGTGCTCGTTGATGGTAAGGCCCTGTCATTAAAAGCGTCAACAAAGT
AG