SecReT6
Protein ID: 108809582
SecReT6 ID140
T6SS typeN/A
Gene symbol-
Locus tagYPA_3591
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]4023305..4024288 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ1C1W9
KEGG IDypa:YPA_3591
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.00E-66, Aligned region: 18..312
Protein Sequence: 327 a.a.     [Download]
>gi|108809582|ref|YP_653498.1| hypothetical protein YPA_3591 [Yersinia pestis Antiqua]
MASLQTLKNTFLPGISASQDFFELLRRIERATPEQGRLGTQRDRSHLRLRIIQPADMGFAPREVSDIRQT
LNTHQHLAEITIFCRHFGLFAPYGPLPIHVTEHARNEALAKRNQAFEHFAGILSQRMAILHYRSWAQMHV
AVGHDRASANPFMNHVRQIAGLTPQQALNSHVDRVRRCFPGVYLPGRGSLRKLQEILSLYFSVPIRVEAR
KGLWIDDSRNIESQRMGRLGNTRIGSRFFDVQHSLVLSIGPVSDPQYLDFQRNSKRINTLVQICHDFVRH
RMVLDVQLIIQTSPNMACRLGGGTLSRHSWLKPGSALSIQPIYRTVT
 
Nucleotide Sequence: 984 bp     [Download]
>gi|108805998|ref|NC_008150.1|:c4024288-4023305 Yersinia pestis Antiqua chromosome, complete genome
ATGGCTAGCCTCCAGACGCTGAAAAACACGTTTCTGCCGGGTATCTCGGCCAGTCAGGACTTTTTCGAGT
TGCTGCGTCGCATTGAGCGTGCCACTCCAGAGCAAGGCCGGCTTGGCACCCAACGTGATCGTAGCCATCT
GCGGCTACGTATTATTCAGCCTGCCGATATGGGATTTGCACCGCGTGAAGTGAGTGATATCAGGCAAACG
CTGAACACTCATCAGCATCTGGCAGAGATCACCATTTTCTGCCGCCATTTTGGTTTATTTGCCCCGTATG
GCCCGTTGCCAATACATGTTACCGAACATGCTCGTAACGAAGCGTTGGCTAAACGTAATCAGGCCTTTGA
ACATTTTGCGGGCATTCTCAGCCAGCGAATGGCGATCTTGCATTATCGCTCTTGGGCCCAAATGCACGTC
GCCGTGGGGCATGATCGCGCGTCAGCCAATCCCTTTATGAACCATGTGCGTCAAATCGCGGGCCTAACGC
CGCAGCAAGCGCTGAATTCACATGTGGATCGGGTACGGCGTTGCTTTCCGGGGGTGTATCTGCCGGGCAG
AGGATCATTACGCAAATTACAGGAGATCCTGAGCCTGTATTTCTCGGTTCCTATCCGTGTTGAAGCCCGT
AAAGGATTGTGGATTGACGACTCGCGCAATATAGAAAGCCAACGTATGGGACGGTTGGGTAACACGCGTA
TTGGCAGCCGTTTCTTCGATGTGCAGCACAGCCTGGTGTTATCTATTGGTCCGGTATCTGACCCCCAATA
TCTGGATTTTCAACGCAACAGCAAACGCATTAACACTCTGGTGCAAATCTGCCATGACTTTGTCCGCCAT
CGGATGGTGCTGGACGTGCAATTAATCATACAGACCTCACCCAATATGGCTTGTCGTCTTGGCGGTGGAA
CGCTCAGTCGCCATAGCTGGTTAAAGCCAGGCTCAGCCTTGAGTATACAGCCAATTTATAGAACGGTTAC
CTAG