SecReT6
Protein ID: 108809583
SecReT6 ID140
T6SS typeN/A
Gene symbol-
Locus tagYPA_3592
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]4024281..4026125 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ1C1W8
KEGG IDypa:YPA_3592
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-143, Aligned region: 6..609
Protein Sequence: 614 a.a.     [Download]
>gi|108809583|ref|YP_653499.1| hypothetical protein YPA_3592 [Yersinia pestis Antiqua]
MPNESFLALYNEELRYLREDGQRFAHMHPQVAQHLGLHADGVLDPFVERLLEGTAFLSSRIQQRLNNEHP
EFALQMLGRLAPLWYTPLPSIATIAMVPDLTSPQWHSRVVLPKGSRVTLSDSSLNNRLANFSTGRTLKIQ
PLVIENAECASTPPAYLPLSVASQLQAGQAHLRLRLTTQGVASLSELDFAPMNLTLAGGIIQSNQLITTL
LNNTLHIVLWANTDGKPLVKVLTKEHLRQGGLDEQEALLPVAISEMPGNRLLREYFAAPSRFFDLELHGL
NDFLQQGDGIHTFEVLFVLDQRPLHLIDRVTGNDFRLFATPIINLFKRRCSPVLINGEHTEYPVIVDPLN
PRLYEVHHVLGVNGLLSEGGSVQFSSLHGHARFDDDDKMAGYSIRRRRDFTDKNHQKNSPLPHDSLFIAL
SPGTSGIDIDHVKSLSIEAMVCERHLIPSQLQHPEFKLEIALPVGQIEMLRHPAKPQGVPNIDQAWRALQ
LIANNPLRYALPDVTDCSPLLKDWLSIFCQHEEASQHKRITSLTHASVAHNFERHTAPGPIAWSRGVEAT
LDFNSSHHSDKGAFLFARILHHALSEYCELGQTLRLHMQVDGETFAKWGPVNYG
 
Nucleotide Sequence: 1845 bp     [Download]
>gi|108805998|ref|NC_008150.1|:c4026125-4024281 Yersinia pestis Antiqua chromosome, complete genome
ATGCCCAACGAAAGTTTTCTGGCTCTATACAACGAAGAGTTGCGTTATCTGCGTGAAGATGGGCAGCGCT
TCGCTCATATGCATCCGCAAGTCGCCCAACACCTTGGGTTACATGCTGATGGTGTGCTCGATCCTTTCGT
CGAACGGCTCCTTGAAGGCACCGCTTTCTTGAGTTCCCGTATCCAACAGCGTTTGAACAACGAGCATCCA
GAGTTTGCTTTGCAAATGCTTGGGCGTTTGGCCCCACTTTGGTATACACCCCTGCCGTCGATTGCCACCA
TTGCCATGGTTCCGGATCTTACGTCACCGCAATGGCACTCGCGCGTCGTATTGCCTAAAGGTAGCCGCGT
GACATTGAGTGACAGTTCGCTGAACAACCGGTTGGCGAATTTCTCTACTGGCCGCACGCTGAAAATACAG
CCATTGGTCATTGAAAATGCCGAGTGTGCTAGCACGCCACCGGCGTATTTACCGCTCTCTGTGGCTTCAC
AATTACAAGCTGGTCAGGCCCATCTGCGCTTGCGTCTGACCACTCAAGGTGTCGCGTCTTTATCTGAGCT
GGATTTCGCCCCGATGAACCTGACGCTAGCGGGGGGAATAATTCAGTCAAATCAGTTAATCACGACACTG
TTGAATAACACCTTACATATTGTTTTGTGGGCCAACACGGATGGGAAACCGCTGGTCAAAGTTCTTACCA
AAGAACATCTTCGCCAGGGAGGGCTGGATGAACAAGAGGCGCTTTTACCTGTTGCGATCAGCGAAATGCC
TGGAAACCGTTTGCTACGAGAATATTTTGCTGCTCCTTCGCGTTTTTTCGATCTGGAACTGCATGGCCTC
AACGACTTCCTGCAACAAGGGGACGGCATTCATACCTTTGAGGTGCTGTTTGTACTGGATCAGCGCCCCC
TACATTTGATTGATAGGGTCACTGGCAATGACTTCCGACTCTTCGCCACACCTATTATTAACCTGTTCAA
ACGCCGTTGTAGCCCGGTGCTGATTAATGGTGAACACACCGAATATCCCGTCATTGTTGACCCCCTGAAC
CCCCGCTTGTACGAAGTCCATCATGTACTCGGGGTCAACGGTTTGTTGAGCGAAGGGGGGAGCGTGCAGT
TTTCTTCCCTTCATGGTCATGCCCGTTTTGATGATGACGATAAAATGGCGGGTTACAGCATTCGCCGTCG
CCGCGACTTCACGGATAAAAATCATCAGAAAAATTCACCTTTACCTCATGACAGCTTATTCATTGCCCTT
TCACCGGGGACCAGCGGGATAGATATTGATCACGTCAAGTCGCTGTCGATTGAAGCCATGGTGTGCGAAC
GCCACTTAATTCCCAGCCAATTACAGCATCCGGAATTCAAGCTGGAAATTGCCCTGCCAGTGGGGCAGAT
CGAAATGCTGCGTCACCCGGCAAAACCACAGGGTGTGCCGAATATTGATCAAGCCTGGCGGGCGTTACAA
CTGATTGCCAACAATCCGCTGCGTTATGCGCTGCCGGATGTCACCGATTGTTCGCCGCTGCTAAAAGATT
GGCTGTCGATATTTTGTCAGCATGAAGAGGCGAGCCAGCATAAGAGGATCACTAGCCTGACTCACGCCAG
TGTGGCGCATAATTTTGAACGTCATACCGCTCCGGGGCCGATCGCCTGGAGCCGGGGGGTTGAAGCCACA
CTGGATTTCAACAGCAGCCACCACAGTGATAAAGGTGCATTCCTCTTTGCGCGGATCCTGCATCACGCGC
TGTCAGAATATTGTGAATTAGGGCAGACCCTGAGGTTACACATGCAGGTTGATGGTGAAACCTTCGCCAA
ATGGGGGCCTGTCAACTATGGCTAG