SecReT6
Protein ID: 108809585
SecReT6 ID140
T6SS typeN/A
Gene symbol-
Locus tagYPA_3594
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]4026675..4027193 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ1C1W6
KEGG IDypa:YPA_3594
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.60E-33, Aligned region: 8..148
Protein Sequence: 172 a.a.     [Download]
>gi|108809585|ref|YP_653501.1| hypothetical protein YPA_3594 [Yersinia pestis Antiqua]
MAALVDYFLHIEGVDGESPDQQYNGWIQVQAWQWAEENAGRWGLGGGGGSGKVEMKDFEFRMVSNKASPK
LFLMCAIGEHIPQAKLVCRKSGQGQQDFLIVTFSNCLVSSFKTVGNMPLGKGDAVFTDTVLPTDAISLNF
ARIEVEYKEQQPDGSMGAVIKAGYDLKLNSRI
 
Nucleotide Sequence: 519 bp     [Download]
>gi|108805998|ref|NC_008150.1|:c4027193-4026675 Yersinia pestis Antiqua chromosome, complete genome
ATGGCAGCTTTAGTCGATTACTTTCTCCATATCGAAGGTGTAGATGGTGAGTCTCCCGATCAGCAGTATA
ACGGATGGATCCAAGTACAGGCTTGGCAATGGGCGGAGGAGAATGCGGGGCGCTGGGGGCTAGGTGGCGG
TGGTGGTTCTGGGAAAGTCGAAATGAAGGACTTCGAATTTCGCATGGTGAGTAACAAAGCATCACCAAAA
CTATTTTTGATGTGTGCCATCGGTGAACACATTCCGCAGGCCAAGTTGGTGTGTCGTAAATCAGGTCAAG
GTCAACAAGACTTCCTGATTGTTACCTTCAGTAACTGTCTGGTGTCCTCCTTTAAAACTGTCGGCAACAT
GCCTCTTGGTAAAGGGGACGCAGTATTCACCGACACGGTGCTGCCAACGGATGCCATCAGCCTTAACTTT
GCACGTATCGAAGTGGAATACAAAGAGCAGCAACCTGATGGCTCGATGGGGGCCGTGATTAAGGCTGGTT
ACGATCTGAAATTGAACAGCCGTATTTAA