SecReT6
Protein ID: 108809586
SecReT6 ID140
T6SS typeN/A
Gene symbol-
Locus tagYPA_3595
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]4027356..4028261 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ1C1W5
KEGG IDypa:YPA_3595
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.90E-116, Aligned region: 12..293
Protein Sequence: 301 a.a.     [Download]
>gi|108809586|ref|YP_653502.1| hypothetical protein YPA_3595 [Yersinia pestis Antiqua]
MWITIAPFVTGNPRDIGKIFTTPEYAPWRRLRESNDSRYLVLTLPRFLSRLPYGAKNHPIDDFAFEEVVS
PHASEDFTWANAAYAMGVNINRAFNEYGWCSRIRGIESGGAVEELPAYAFPSDEGGYELTCPTELAISDR
RENELSNAGFLPLVYRKNSDFAAFIGSCTLHAPANYDDPDATANARLSARLPYIFATCRFAHYLKCIVRD
KIGSFRSRDDMQLWLNDWVMNYVDGDPSISTEATKAKRPLAAAEVQVEDVEDDPGFYRAHFYLRPHYQLE
GMTVSLRLVSKLPSNKESEKK
 
Nucleotide Sequence: 906 bp     [Download]
>gi|108805998|ref|NC_008150.1|:c4028261-4027356 Yersinia pestis Antiqua chromosome, complete genome
GTGTGGATCACTATTGCACCGTTCGTTACAGGTAACCCAAGGGATATCGGCAAAATCTTTACCACACCTG
AATATGCGCCATGGAGACGTTTACGTGAGAGTAATGACTCCCGCTATCTGGTACTGACTCTGCCACGTTT
TCTTTCGCGTCTGCCGTATGGTGCCAAAAATCATCCTATTGATGATTTTGCTTTTGAAGAAGTGGTTAGC
CCTCATGCCAGTGAGGATTTCACCTGGGCGAATGCGGCCTATGCCATGGGCGTCAATATTAACCGGGCCT
TCAATGAATATGGTTGGTGTTCAAGGATCCGCGGTATTGAGTCGGGGGGGGCCGTAGAAGAACTTCCGGC
CTATGCTTTTCCTTCTGACGAAGGCGGATATGAACTCACTTGTCCGACAGAATTGGCAATTTCGGACCGT
CGTGAGAACGAGCTATCCAATGCTGGGTTTTTACCGCTGGTCTACCGTAAGAACTCAGACTTTGCCGCCT
TTATCGGGTCGTGCACCCTGCATGCACCGGCAAACTATGATGACCCCGATGCGACGGCGAACGCCAGATT
ATCGGCCCGTTTACCTTACATTTTTGCCACCTGTCGTTTCGCCCATTACCTCAAATGTATTGTGCGCGAC
AAAATTGGTTCGTTCCGCTCGCGGGATGACATGCAACTTTGGCTTAACGACTGGGTGATGAACTACGTCG
ATGGTGACCCCTCCATTTCAACAGAAGCCACTAAAGCTAAACGCCCGCTGGCCGCTGCGGAAGTTCAAGT
TGAAGACGTAGAGGATGATCCTGGTTTTTACCGCGCTCACTTCTATTTACGCCCTCACTACCAACTTGAA
GGTATGACGGTTTCTCTGCGGCTGGTTTCTAAACTTCCATCCAACAAGGAAAGCGAAAAGAAATAA