SecReT6
Protein ID: 108810200
SecReT6 ID128
T6SS typei1
Gene symbol-
Locus tagYPN_0034
StrainYersinia pestis Nepal516
Repliconchromosome [GenBank: NC_008149] [Browse all T6SS(s) in this replicon]
Location [Strand]51216..51713 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ1CNR3
KEGG IDypn:YPN_0034
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.60E-57, Aligned region: 7..160
Protein Sequence: 165 a.a.     [Download]
>gi|108810200|ref|YP_645967.1| hypothetical protein YPN_0034 [Yersinia pestis Nepal516]
MSKNKQSSVAPKERINIKYVPNTGDQVAEIELPLNLLVVGDLKGVREETSIEERQVVSVNKNNFNSVMNE
ANISLSFNVPNRLEGDGEEDMPVALSIKGLDDFSPDNVAKKVPELKKILELREALVALKGPLGNIPAFRS
RLQDLLGNEDMREQLLKELDILNQK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|108810166|ref|NC_008149.1|:51216-51713 Yersinia pestis Nepal516 chromosome, complete genome
ATGAGTAAAAATAAGCAAAGCAGTGTTGCCCCAAAAGAAAGGATTAACATCAAGTATGTGCCGAATACTG
GCGACCAGGTTGCAGAAATTGAATTACCGCTGAATCTGCTGGTTGTGGGTGATCTTAAAGGCGTGCGTGA
AGAGACTTCAATTGAAGAGCGTCAGGTTGTTTCGGTCAATAAGAATAACTTCAACTCAGTCATGAACGAA
GCAAATATCAGTCTGAGTTTCAATGTGCCTAATCGCCTTGAAGGTGATGGGGAAGAAGACATGCCGGTCG
CCTTGTCGATCAAGGGTCTTGATGATTTCTCGCCTGACAATGTGGCGAAAAAAGTTCCAGAGCTCAAAAA
AATTCTGGAACTACGGGAAGCGTTAGTGGCATTGAAAGGGCCATTGGGGAATATCCCAGCTTTCCGCTCT
CGTCTACAGGATTTGCTTGGCAATGAAGATATGCGCGAGCAGTTGCTGAAAGAATTGGACATTCTTAATC
AAAAATAA