SecReT6
Protein ID: 108810203
SecReT6 ID128
T6SS typei1
Gene symbol-
Locus tagYPN_0037
StrainYersinia pestis Nepal516
Repliconchromosome [GenBank: NC_008149] [Browse all T6SS(s) in this replicon]
Location [Strand]53709..54935 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ1CNR0
KEGG IDypn:YPN_0037
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.70E-123, Aligned region: 3..354
Protein Sequence: 408 a.a.     [Download]
>gi|108810203|ref|YP_645970.1| hypothetical protein YPN_0037 [Yersinia pestis Nepal516]
MSFEKYFRDELDYLRQLGRDAAIERPHLAAFLSEQGSDPDVERLLEGFAFLTGNLREKIDDQFPELTHGL
LNMLWPNYLRPIPSMTIIEYTPDESVVTEATLVKRGSQVMSIPIAQNGQRSAFINSNAHAGPQCTFTLCR
DVWLFPMSIREISANSSNEQGILSIHFAAKAELNLQDLQLDKLRFYLGEDNYTSTQLYFWINHYFERAEL
VVNGITIPMPDFDFNPVGFERDDALLPYPKNAYMGYRILQEYFCFPEGFLFFDVNGVVDFPPHLNASEFS
LNLYFSQALPPEVKVRSTTLRMNCTPAVNLFQHDSEAIDLDGTQTEYPLCVSYHNPDHYDIFSVDRVDSW
LSEKGVPKGRGRALNPKTWTSALLLFYLSPVFCRTHSACFQANALCIVIMDIFYNVTL
 
Nucleotide Sequence: 1227 bp     [Download]
>gi|108810166|ref|NC_008149.1|:53709-54935 Yersinia pestis Nepal516 chromosome, complete genome
ATGTCGTTCGAAAAGTATTTCAGGGACGAGCTGGACTACCTCCGGCAATTAGGACGCGATGCCGCAATAG
AACGGCCTCATCTCGCTGCATTTTTATCTGAGCAAGGTTCTGATCCGGATGTTGAACGTTTGCTGGAAGG
CTTTGCTTTTCTAACGGGCAACCTGCGTGAAAAAATCGATGATCAATTCCCTGAATTGACTCATGGTTTA
CTGAATATGTTGTGGCCGAACTACTTACGGCCAATACCGAGCATGACCATCATCGAGTACACACCGGATG
AAAGTGTGGTCACCGAGGCGACGCTGGTGAAACGGGGTAGCCAAGTGATGAGTATCCCCATCGCACAAAA
TGGTCAGCGCAGCGCGTTTATCAACAGTAATGCTCATGCCGGGCCACAATGTACTTTTACGTTGTGCCGT
GATGTGTGGTTGTTCCCCATGTCCATCCGGGAGATCTCGGCGAACAGCAGTAACGAACAAGGCATTTTGA
GTATTCACTTTGCCGCCAAAGCGGAATTGAACTTACAAGACCTGCAATTGGATAAATTGCGCTTTTATCT
GGGCGAAGACAACTACACCAGCACACAACTCTATTTCTGGATTAACCACTATTTCGAACGCGCTGAACTG
GTTGTCAACGGGATAACCATCCCGATGCCTGATTTTGACTTTAACCCAGTGGGCTTTGAACGCGATGATG
CCCTCTTGCCGTACCCGAAAAACGCCTATATGGGTTACCGGATCCTGCAAGAATATTTTTGCTTCCCCGA
AGGCTTTTTGTTCTTTGATGTCAATGGTGTGGTCGATTTTCCGCCGCACTTGAATGCCAGTGAATTCTCT
CTGAATTTGTATTTCTCTCAGGCATTGCCGCCTGAAGTGAAAGTCCGCTCCACCACACTGCGGATGAATT
GCACACCTGCGGTGAACCTGTTCCAACATGACAGTGAAGCGATTGATCTTGATGGAACCCAGACGGAATA
TCCGCTCTGTGTCAGCTACCATAATCCGGATCACTACGACATCTTTTCAGTTGATCGGGTTGACAGTTGG
CTCAGTGAAAAAGGTGTTCCTAAGGGGCGCGGCCGTGCACTGAACCCCAAAACTTGGACATCTGCTTTAC
TGCTTTTCTACCTGAGTCCGGTATTCTGCCGGACTCATTCCGCCTGTTTTCAGGCTAATGCGCTCTGTAT
TGTAATAATGGATATATTCTACAATGTCACGCTTTAA