SecReT6
Protein ID: 108810539
SecReT6 ID129
T6SS typei3
Gene symbol-
Locus tagYPN_0374
StrainYersinia pestis Nepal516
Repliconchromosome [GenBank: NC_008149] [Browse all T6SS(s) in this replicon]
Location [Strand]451919..452917 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ1CMS4
KEGG IDypn:YPN_0374
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.10E-08, Aligned region: 49..106
ImpA-rel_N [PF06812], Evalue: 3.10E-08, Aligned region: 178..198
Protein Sequence: 332 a.a.     [Download]
>gi|108810539|ref|YP_646306.1| hypothetical protein YPN_0374 [Yersinia pestis Nepal516]
MDNNMSDIFPQALFGVEYDPAYGEIESILSQLDESADPLSRPHEPPQINWHHISEQANKLLEQCFDLRVM
LWFIRANIHIKGISALYDGFMRINAQTQDTDVVIYPQSEEPPLNSGHAAALGWLSTAQCIAELKTARLTE
EHPYILQDLITTEALPNGQERYFVTSSTLFLTVNNYFQQNGLPDLKDQLTKVDMLLEQIESYANQSTESY
QLHCEQLRIFLKNNISQLAQLNAPEHDDPETVYQKIDSHESLDTQSFNSNDKSIRSRQEIIMMLDRILEY
FQHYEPSHPAPIFIRRTKEMIGMDFYSIVEEILPEAVITLKQFTGKTNLPFR
 
Nucleotide Sequence: 999 bp     [Download]
>gi|108810166|ref|NC_008149.1|:451919-452917 Yersinia pestis Nepal516 chromosome, complete genome
ATGGACAATAATATGAGTGACATATTTCCTCAAGCATTATTCGGCGTTGAATATGATCCGGCCTATGGCG
AGATTGAGTCCATCCTCTCTCAATTAGATGAGTCTGCGGACCCCCTTTCCCGCCCGCATGAACCCCCTCA
AATAAACTGGCACCATATCAGTGAGCAAGCCAATAAGCTGCTAGAGCAATGTTTTGATTTACGTGTAATG
CTTTGGTTTATAAGGGCAAATATTCATATAAAAGGAATATCGGCCCTCTATGATGGCTTTATGCGCATTA
ATGCACAAACCCAAGATACTGATGTTGTTATCTACCCTCAATCGGAAGAACCGCCATTAAATAGTGGGCA
TGCCGCCGCATTAGGTTGGTTATCTACAGCACAATGTATTGCAGAGCTTAAGACTGCACGCCTTACAGAA
GAGCACCCTTACATTTTACAAGATCTTATTACGACTGAAGCGTTACCCAATGGCCAAGAGAGATATTTTG
TTACATCTTCGACATTATTTTTAACTGTCAATAATTATTTCCAACAGAATGGATTGCCAGATTTAAAAGA
CCAATTGACAAAAGTAGATATGTTGTTGGAACAAATTGAGTCCTATGCAAATCAATCCACAGAGAGTTAC
CAACTGCATTGTGAACAATTACGTATTTTCTTAAAAAATAATATTTCTCAGCTTGCACAATTGAATGCCC
CAGAACATGACGATCCCGAAACTGTTTATCAAAAAATAGACAGTCATGAATCTCTTGATACTCAGTCCTT
TAATTCAAATGATAAGAGCATTCGCTCACGGCAAGAGATCATTATGATGCTGGACCGTATTCTAGAGTAC
TTTCAACATTATGAGCCTAGTCATCCAGCCCCAATATTCATTCGCCGTACCAAAGAGATGATAGGTATGG
ATTTTTATTCCATTGTTGAAGAAATTCTGCCTGAAGCTGTAATTACATTAAAACAGTTTACCGGAAAAAC
TAACCTACCGTTTCGATGA