SecReT6
Protein ID: 108810540
SecReT6 ID129
T6SS typei3
Gene symbol-
Locus tagYPN_0375
StrainYersinia pestis Nepal516
Repliconchromosome [GenBank: NC_008149] [Browse all T6SS(s) in this replicon]
Location [Strand]452928..453488 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ1CMS3
KEGG IDypn:YPN_0375
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.00E-57, Aligned region: 11..165
Protein Sequence: 186 a.a.     [Download]
>gi|108810540|ref|YP_646307.1| hypothetical protein YPN_0375 [Yersinia pestis Nepal516]
MAKDASSQKFIGRNNAPRVQIEYDVEIYGSNKKVELPFVTGVMADLSGHRAKPLPAVEDRKFLTFDQDNF
DARMRAIKPRLKFYVDNTLSEDNELLDIELDFESMDDFSPGSLARRIPQMEKLLEARTHLAELITYMDGK
TSAEEVVKQLLEQPDFLQNLATDAQGTISKLSQDDDVLVEDDDGEK
 
Nucleotide Sequence: 561 bp     [Download]
>gi|108810166|ref|NC_008149.1|:452928-453488 Yersinia pestis Nepal516 chromosome, complete genome
ATGGCCAAAGATGCGAGCTCGCAAAAATTTATCGGTAGAAATAATGCACCTAGAGTGCAAATTGAATATG
ACGTCGAAATTTATGGTTCAAATAAGAAAGTAGAGTTGCCTTTTGTAACCGGCGTGATGGCTGATCTTTC
TGGCCACAGAGCAAAGCCTCTTCCTGCTGTTGAAGATCGTAAATTCCTTACTTTCGATCAGGATAATTTC
GATGCCCGGATGAGAGCAATTAAGCCTCGCCTTAAATTCTACGTAGATAACACCTTGAGTGAGGATAACG
AACTCCTGGATATCGAACTGGATTTTGAGTCAATGGATGACTTTTCCCCCGGATCGTTAGCGCGGCGTAT
TCCTCAAATGGAAAAACTGCTTGAGGCACGCACCCATCTGGCTGAATTGATCACCTATATGGATGGTAAA
ACCAGCGCAGAAGAGGTGGTTAAACAACTGCTTGAACAACCTGATTTTTTACAAAATCTTGCGACCGATG
CACAGGGAACTATTTCGAAGCTCAGCCAGGATGATGATGTTTTAGTGGAAGATGACGATGGAGAAAAATA
G