SecReT6
Protein ID: 108810541
SecReT6 ID129
T6SS typei3
Gene symbol-
Locus tagYPN_0376
StrainYersinia pestis Nepal516
Repliconchromosome [GenBank: NC_008149] [Browse all T6SS(s) in this replicon]
Location [Strand]453488..454999 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ1CMS2
KEGG IDypn:YPN_0376
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.00E-184, Aligned region: 69..495
Protein Sequence: 503 a.a.     [Download]
>gi|108810541|ref|YP_646308.1| hypothetical protein YPN_0376 [Yersinia pestis Nepal516]
MENMQKAQLNDTPDINVDLAENELDDILKRSFRPRTDEASATVRRAIGTLAAYANKGQVKVNRDVVLTIE
SLVAEIDEKLSDQMNLILHHKEFQKLESAWRGLSYLVDNTDANETLKIRVLNISQDELGKTLRRYRGSAW
DQSPIFKQVYEHEYGQFGGEPFGCMIGDYEFDHSPQSVALLTELAKVAAAAHCPFITSSSPSIMQMNNWR
ELGNPRDIGKIFTTPEYAPWRRLRESNDSRYLVLTLPRFLSRLPYGAKNHPIDDFAFEEVVSPHASEDFT
WANAAYAMGVNINRAFNEYGWCSRIRGIESGGSVEELPAYAFPSDEGGYELTCPTELAISDRRENELSNA
GFLPLVYRKNSDFAAFIGSCTLHAPANYDDPDATANARLSARLPYIFATCRFAHYLKCIVRDKIGSFRSR
DDMQLWLNDWVMNYVDGDPSISTEATKAKRPLAAAEVQVEDVEDDPGFYRAHFYLRPHYQLEGMTVSLRL
VSKLPSNKESEKK
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|108810166|ref|NC_008149.1|:453488-454999 Yersinia pestis Nepal516 chromosome, complete genome
GTGGAGAACATGCAGAAAGCCCAACTCAATGACACGCCAGACATCAACGTCGATCTGGCTGAAAACGAGT
TAGATGACATTTTAAAACGTTCTTTTCGCCCTCGAACTGACGAAGCTTCCGCCACAGTGCGCCGTGCCAT
AGGCACGCTTGCTGCGTATGCCAATAAAGGCCAAGTGAAAGTCAATCGTGATGTCGTACTGACCATTGAG
TCTTTAGTCGCTGAAATTGACGAAAAACTTTCCGATCAAATGAACCTTATTCTGCACCATAAAGAGTTCC
AAAAGCTGGAATCAGCTTGGCGCGGGCTTAGCTATCTTGTTGATAATACAGATGCTAATGAAACTTTAAA
AATACGGGTACTGAACATTAGCCAAGATGAACTGGGGAAAACGCTTCGCCGTTATCGTGGCTCTGCATGG
GATCAAAGTCCGATATTTAAACAGGTCTATGAACATGAATATGGGCAGTTTGGTGGGGAACCTTTTGGTT
GCATGATCGGTGATTATGAATTCGATCACAGTCCACAGAGTGTGGCTCTGCTGACCGAGTTAGCCAAGGT
GGCCGCCGCCGCTCACTGTCCTTTCATTACCTCTTCTTCCCCAAGCATCATGCAGATGAATAACTGGAGG
GAGCTGGGTAACCCAAGGGATATCGGCAAAATCTTTACCACACCTGAATATGCGCCATGGAGACGTTTAC
GTGAGAGTAATGACTCCCGCTATCTGGTACTGACTCTGCCACGTTTTCTTTCGCGTCTGCCGTATGGTGC
CAAAAATCATCCTATTGATGATTTTGCTTTTGAAGAAGTGGTTAGCCCTCATGCCAGTGAGGATTTCACC
TGGGCGAATGCGGCCTATGCCATGGGCGTCAATATTAACCGGGCCTTCAATGAATATGGTTGGTGTTCAA
GGATCCGCGGTATTGAGTCGGGGGGGTCCGTAGAAGAACTTCCGGCCTATGCTTTTCCTTCTGACGAAGG
CGGATATGAACTCACTTGTCCGACAGAATTGGCAATTTCGGACCGTCGTGAGAACGAGCTATCCAATGCT
GGGTTTTTACCGCTGGTCTACCGTAAGAACTCAGACTTTGCCGCCTTTATCGGGTCGTGCACCCTGCATG
CACCGGCAAACTATGATGACCCCGATGCGACGGCGAACGCCAGATTATCGGCCCGTTTACCTTACATTTT
TGCCACCTGTCGTTTCGCCCATTACCTCAAATGTATTGTGCGCGACAAAATTGGTTCGTTCCGCTCGCGG
GATGACATGCAACTTTGGCTTAACGACTGGGTGATGAACTACGTCGATGGTGACCCCTCCATTTCAACAG
AAGCCACTAAAGCTAAACGCCCGCTGGCCGCTGCGGAAGTTCAAGTTGAAGACGTAGAGGATGATCCTGG
TTTTTACCGCGCTCACTTCTATTTACGCCCTCACTACCAACTTGAAGGTATGACGGTTTCTCTGCGGCTG
GTTTCTAAACTTCCATCCAACAAGGAAAGCGAAAAGAAATAA