SecReT6
Protein ID: 108810544
SecReT6 ID129
T6SS typei3
Gene symbol-
Locus tagYPN_0379
StrainYersinia pestis Nepal516
Repliconchromosome [GenBank: NC_008149] [Browse all T6SS(s) in this replicon]
Location [Strand]456230..458074 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ1CMR9
KEGG IDypn:YPN_0379
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-143, Aligned region: 6..609
Protein Sequence: 614 a.a.     [Download]
>gi|108810544|ref|YP_646311.1| hypothetical protein YPN_0379 [Yersinia pestis Nepal516]
MPNESFLALYNEELRYLREDGQRFAHMHPQVAQHLGLHADGVLDPFVERLLEGTAFLSSRIQQRLNNEHP
EFALQMLGRLAPLWYTPLPSIATIAMVPDLTSPQWHSRVVLPKGSRVTLSDSSLNNRLANFSTGRTLKIQ
PLVIENAECASTPPAYLPLSVASQLQAGQAHLRLRLTTQGVASLSELDFAPMNLTLAGGIIQSNQLITTL
LNNTLHIVLWANTDGKPLVKVLTKEHLRQGGLDEQEALLPVAISEMPGNRLLREYFAAPSRFFDLELHGL
NDFLQQGDGIHTFEVLFVLDQRPLHLIDRVTGNDFRLFATPIINLFKRRCSPVLINGEHTEYPVIVDPLN
PRLYEVHHVLGVNGLLSEGGSVQFSSLHGHARFDDDDKMAGYSIRRRRDFTDKNHQKNSPLPHDSLFIAL
SPGTSGIDIDHVKSLSIEAMVCERHLIPSQLQHPEFKLEIALPVGQIEMLRHPAKPQGVPNIDQAWRALQ
LIANNPLRYALPDVTDCSPLLKDWLSIFCQHEEASQHKRITSLTHASVAHNFERHTAPGPIAWSRGVEAT
LDFNSSHHSDKGAFLFARILHHALSEYCELGQTLRLHMQVDGETFAKWGPVNYG
 
Nucleotide Sequence: 1845 bp     [Download]
>gi|108810166|ref|NC_008149.1|:456230-458074 Yersinia pestis Nepal516 chromosome, complete genome
ATGCCCAACGAAAGTTTTCTGGCTCTATACAACGAAGAGTTGCGTTATCTGCGTGAAGATGGGCAGCGCT
TCGCTCATATGCATCCGCAAGTCGCCCAACACCTTGGGTTACATGCTGATGGTGTGCTCGATCCTTTCGT
CGAACGGCTCCTTGAAGGCACCGCTTTCTTGAGTTCCCGTATCCAACAGCGTTTGAACAACGAGCATCCA
GAGTTTGCTTTGCAAATGCTTGGGCGTTTGGCCCCACTTTGGTATACACCCCTGCCGTCGATTGCCACCA
TTGCCATGGTTCCGGATCTTACGTCACCGCAATGGCACTCGCGCGTCGTATTGCCTAAAGGTAGCCGCGT
GACATTGAGTGACAGTTCGCTGAACAACCGGTTGGCGAATTTCTCTACTGGCCGCACGCTGAAAATACAG
CCATTGGTCATTGAAAATGCCGAGTGTGCCAGCACGCCACCGGCGTATTTACCGCTCTCTGTGGCTTCAC
AATTACAAGCTGGTCAGGCCCATCTGCGCTTGCGTCTGACCACTCAAGGTGTCGCGTCTTTATCTGAGCT
GGATTTCGCCCCGATGAACCTGACGCTAGCGGGGGGAATAATTCAGTCAAATCAGTTAATCACGACACTG
TTGAATAACACCTTACATATTGTTTTGTGGGCCAACACGGATGGGAAACCGCTGGTCAAAGTTCTTACCA
AAGAACATCTTCGCCAGGGAGGGCTGGATGAACAAGAGGCGCTTTTACCTGTTGCGATCAGCGAAATGCC
TGGAAACCGTTTGCTACGAGAATATTTTGCTGCTCCTTCGCGTTTTTTCGATCTGGAACTGCATGGCCTC
AACGACTTCCTGCAACAAGGGGACGGCATTCATACCTTTGAGGTGCTGTTTGTACTGGATCAGCGCCCCC
TACATTTGATTGATAGGGTCACTGGCAATGACTTCCGACTCTTCGCCACACCTATTATTAACCTGTTCAA
ACGCCGTTGTAGCCCGGTGCTGATTAATGGTGAACACACCGAATATCCCGTCATTGTTGACCCCCTGAAC
CCCCGCTTGTACGAAGTCCATCATGTACTCGGGGTCAACGGTTTGTTGAGCGAAGGGGGGAGCGTGCAGT
TTTCTTCCCTTCATGGTCATGCCCGTTTTGATGATGACGATAAAATGGCGGGTTACAGCATTCGCCGTCG
CCGCGACTTCACGGATAAAAATCATCAGAAAAATTCACCTTTACCTCATGACAGCTTATTCATTGCCCTT
TCACCGGGGACCAGCGGGATAGATATTGATCACGTCAAGTCGCTGTCGATTGAAGCCATGGTGTGCGAAC
GCCACTTAATTCCCAGCCAATTACAGCATCCGGAATTCAAGCTGGAAATTGCCCTGCCAGTGGGGCAGAT
CGAAATGCTGCGTCACCCGGCAAAACCACAGGGTGTGCCGAATATTGATCAAGCCTGGCGGGCGTTACAA
CTGATTGCCAACAATCCGCTGCGTTATGCGCTGCCGGATGTCACCGATTGTTCGCCGCTGCTAAAAGATT
GGCTGTCGATATTTTGTCAGCATGAAGAGGCGAGCCAGCATAAGAGGATCACTAGCCTGACTCACGCCAG
TGTGGCGCATAATTTTGAACGTCATACCGCTCCGGGGCCGATCGCCTGGAGCCGGGGGGTTGAAGCCACA
CTGGATTTCAACAGCAGCCACCACAGTGATAAAGGTGCATTCCTCTTTGCGCGGATCCTGCATCACGCGC
TGTCAGAATATTGTGAATTAGGGCAGACCCTGAGGTTACACATGCAGGTTGATGGTGAAACCTTCGCCAA
ATGGGGGCCTGTCAACTATGGCTAG