SecReT6
Protein ID: 108810552
SecReT6 ID129
T6SS typei3
Gene symbol-
Locus tagYPN_0387
StrainYersinia pestis Nepal516
Repliconchromosome [GenBank: NC_008149] [Browse all T6SS(s) in this replicon]
Location [Strand]468443..468934 [+]
Productputative lipoprotein
NoteTssJ
UniProt IDQ1CMR1
KEGG IDypn:YPN_0387
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-17, Aligned region: 16..155
Protein Sequence: 163 a.a.     [Download]
>gi|108810552|ref|YP_646319.1| putative lipoprotein [Yersinia pestis Nepal516]
MRSLFRVLPIFILTGCVLLSGCSWFSSSSEAALQKRRIDLQVVAAPLINPGPNGQAQPLKVCIIELNKEG
WSPPGLYQGTLCSGISVGGEVVSVTEYILAPTEVRQYSRDVPFEQERWWAIAAEFQEMSNGKSLLTLKSD
ARADFNRVVLVDGKALSLKASTK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|108810166|ref|NC_008149.1|:468443-468934 Yersinia pestis Nepal516 chromosome, complete genome
ATGCGTAGCCTCTTTCGTGTGTTGCCTATTTTTATCCTGACAGGTTGCGTCCTGCTCAGCGGCTGTAGCT
GGTTTTCCTCATCCTCAGAAGCGGCGCTACAGAAACGGCGGATTGACTTGCAGGTTGTTGCGGCTCCTCT
CATCAATCCTGGGCCCAACGGTCAGGCACAGCCCTTGAAGGTATGCATTATTGAGCTGAATAAAGAGGGG
TGGTCACCCCCCGGTTTGTATCAGGGGACGCTCTGCAGTGGCATCAGTGTAGGAGGTGAAGTCGTCAGCG
TGACGGAATACATCCTTGCGCCGACAGAGGTGCGTCAATATTCCCGCGATGTTCCCTTTGAACAAGAGCG
CTGGTGGGCAATAGCGGCTGAGTTTCAGGAGATGAGTAACGGTAAAAGCCTATTAACGCTGAAATCTGAT
GCCCGTGCGGACTTCAACCGTGTGGTGCTCGTTGATGGTAAGGCCCTGTCATTAAAAGCGTCAACAAAGT
AG