SecReT6
Protein ID: 108811594
SecReT6 ID130
T6SS typei3
Gene symbol-
Locus tagYPN_1431
StrainYersinia pestis Nepal516
Repliconchromosome [GenBank: NC_008149] [Browse all T6SS(s) in this replicon]
Location [Strand]1627844..1629025 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ1CJR9
KEGG IDypn:YPN_1431
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.70E-18, Aligned region: 62..121
ImpA-rel_N [PF06812], Evalue: 3.70E-18, Aligned region: 203..215
Protein Sequence: 393 a.a.     [Download]
>gi|108811594|ref|YP_647361.1| hypothetical protein YPN_1431 [Yersinia pestis Nepal516]
MSEQSIAERAGYYQSMMQPIPGDFPCGKNLEYDPAFIMLQTKLQPKQAAEYGNFVEVAEPNNWTDIERKC
LELLNNSRDIRLFIILMRCRMRQVGVGALQEGLEAILWCLDTWPDQLHPQLFDEGEFEPLMRGNAFAELE
DIDGFIADFRNQQLPKAAGVQLSIKEFEKAHSVPREEGALDEGTLEAVKQEWQNRSDHTILSLQHAYALL
QGLATRLNNSLGEDTPDFVRMTSVLRHFDAAITPIAPIVVPIPEVVELYPVATAMLASTEMPVTAEVQTV
AETQMAIPIEAPQQRQAVVTPSPQLQPLQLQSAQLQPVPIQSQPVPVQQQGIQNRADALARLIEVREWFT
SMEPSSPVIALLAFSEKTIGKSFGELLQFIPQELISKLNEGQE
 
Nucleotide Sequence: 1182 bp     [Download]
>gi|108810166|ref|NC_008149.1|:c1629025-1627844 Yersinia pestis Nepal516 chromosome, complete genome
ATGAGTGAACAGAGTATCGCTGAACGTGCCGGTTATTATCAAAGCATGATGCAGCCCATTCCAGGTGACT
TTCCTTGTGGCAAAAATCTGGAATATGACCCGGCATTTATTATGCTACAGACAAAATTGCAACCTAAGCA
GGCCGCTGAATACGGCAATTTTGTTGAGGTCGCTGAACCCAATAACTGGACAGATATCGAGCGTAAATGC
CTTGAACTCCTGAATAATTCTCGGGATATTCGGCTGTTTATTATTCTGATGCGCTGCCGGATGCGTCAGG
TCGGTGTGGGCGCGTTGCAAGAAGGGCTGGAAGCCATACTTTGGTGCCTCGACACTTGGCCTGATCAGCT
ACATCCTCAGTTGTTTGATGAAGGGGAATTTGAACCTTTAATGCGCGGTAATGCTTTTGCTGAACTGGAA
GATATTGATGGTTTTATCGCCGACTTCCGTAATCAGCAGTTACCCAAAGCCGCTGGCGTGCAACTTTCCA
TCAAAGAGTTTGAAAAAGCACACTCCGTTCCTCGAGAAGAAGGGGCATTGGACGAAGGGACTCTGGAAGC
CGTTAAGCAAGAGTGGCAGAACCGATCAGATCACACCATTCTCTCACTCCAGCACGCTTATGCCTTGTTG
CAAGGATTAGCCACGCGCCTCAACAACTCCCTCGGTGAAGACACACCTGATTTTGTCAGAATGACCTCAG
TGTTACGCCACTTTGATGCCGCGATAACCCCGATAGCGCCTATCGTGGTGCCGATCCCAGAAGTTGTCGA
GCTCTATCCAGTCGCCACAGCGATGCTAGCAAGCACAGAAATGCCAGTGACCGCCGAGGTACAGACGGTT
GCAGAGACACAAATGGCCATACCCATTGAAGCTCCCCAACAGCGTCAAGCGGTGGTAACCCCATCCCCAC
AGTTGCAGCCGTTACAGTTGCAATCGGCACAGTTGCAACCTGTACCGATACAGTCACAGCCGGTGCCTGT
CCAGCAGCAAGGGATCCAAAACAGGGCTGATGCATTAGCCCGGCTTATAGAGGTGCGAGAGTGGTTTACC
TCCATGGAACCGAGTAGCCCGGTCATTGCCTTACTGGCTTTTTCAGAAAAAACTATCGGCAAAAGCTTCG
GCGAATTGCTGCAGTTCATTCCTCAGGAACTGATTTCGAAACTCAATGAAGGACAGGAGTAA