SecReT6
Protein ID: 108811596
SecReT6 ID130
T6SS typei3
Gene symbol-
Locus tagYPN_1433
StrainYersinia pestis Nepal516
Repliconchromosome [GenBank: NC_008149] [Browse all T6SS(s) in this replicon]
Location [Strand]1630149..1632029 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ1CJR7
KEGG IDypn:YPN_1433
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.90E-202, Aligned region: 5..625
Protein Sequence: 626 a.a.     [Download]
>gi|108811596|ref|YP_647363.1| hypothetical protein YPN_1433 [Yersinia pestis Nepal516]
MDHKFLDYYNKELTFMREMAQEFAEKHPKIAGRLGMHGIEVADPYVERLIESFCFLSARTQIKLDAEFPK
FTQRLLDIVYPNYNSPTPSMGVIQLKPNLKEGDLTQGYCVPRGSSFFTHIAPGETTRCEFRSGQDVELWP
LEIAEARLSSVPPDMPNLEKHRIAYHRLKGALRIKLKLVGDLTFSQLEGLDRLPIYIDGDERIVSHIFEL
LHASHVATIIRAGHGETAKDTVISDQPLSFEGLSPDQSLLPLSWNIFHGHNLVQEYFTCRQRFYFFTLTQ
LSQSLRDNHTGEAEIIILLDRLPQDLVSHVAPSRFLLACTPVINLFPKRMDKIEINRALNDFHVVPDRSR
PLDYEVFAINKVFGQQAETSNEVVFNPLYQTRHCDNGNFGRYFSITRKARTGDSNKRKYDTRTPYASTEV
FVSLVDQQEAPYGDSLRYLSIEAQVTNRDLPRLISASGNFELTMSDSAPVHGARFVFQPSAPRAPFAMDE
SAWRLIRQLSFNYLPLSDMSHSNGGESLRNMLRLFVNASDHESNTQIDALVGCKSEPVIRRLPGNGLLVY
GRGICCTLTVDEEGFSGISPYLFGMIMENYVARHAAINVFTETELNSMQRGRVGHWKARPGRRGVL
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|108810166|ref|NC_008149.1|:c1632029-1630149 Yersinia pestis Nepal516 chromosome, complete genome
GTGGATCACAAATTTCTTGACTATTACAATAAAGAACTCACTTTTATGCGCGAGATGGCGCAAGAGTTTG
CTGAAAAACATCCCAAAATAGCAGGCCGCCTGGGCATGCATGGGATTGAAGTCGCCGACCCTTACGTTGA
GCGGCTGATAGAGTCCTTCTGTTTTTTATCTGCCAGAACGCAGATTAAGTTGGATGCTGAGTTTCCTAAA
TTTACTCAGCGTCTTTTGGACATTGTCTATCCCAATTACAATTCGCCAACCCCCTCAATGGGCGTGATCC
AACTTAAGCCAAATCTGAAGGAAGGAGATTTGACTCAAGGGTATTGTGTTCCCAGGGGCAGCTCGTTCTT
CACCCATATCGCACCTGGCGAGACAACCCGCTGCGAGTTCCGCAGTGGTCAGGATGTGGAGTTGTGGCCA
CTGGAAATAGCAGAAGCGCGTCTAAGCTCTGTTCCCCCGGATATGCCTAATCTGGAAAAGCACCGCATTG
CCTATCATCGGCTTAAAGGTGCCTTACGCATTAAATTAAAATTAGTGGGCGATCTCACTTTCTCACAATT
AGAAGGCCTTGATCGGCTGCCTATTTATATTGATGGTGATGAACGAATCGTTTCACATATCTTCGAGCTA
CTCCACGCCAGCCATGTTGCTACCATCATACGGGCAGGCCACGGAGAGACAGCAAAAGACACCGTGATCA
GTGATCAGCCACTGTCCTTTGAAGGGCTAAGCCCCGACCAAAGCCTACTGCCGCTATCATGGAATATCTT
TCACGGACATAATCTGGTGCAGGAATACTTTACCTGCCGCCAGCGTTTCTACTTTTTTACGCTGACACAG
CTGTCGCAAAGTTTGCGCGATAATCATACCGGTGAAGCGGAAATCATCATCCTACTGGACAGATTACCGC
AGGATTTGGTGAGCCATGTTGCCCCCTCTCGCTTCCTGTTAGCCTGCACGCCAGTGATTAATCTCTTTCC
TAAACGCATGGATAAGATCGAAATTAACCGTGCACTGAACGATTTTCACGTAGTACCAGACCGTAGCCGC
CCACTGGATTATGAGGTTTTCGCCATTAATAAAGTGTTTGGTCAACAGGCGGAAACCAGCAACGAGGTGG
TATTTAACCCACTTTATCAAACCCGTCACTGTGATAATGGCAACTTTGGGCGTTATTTCTCCATCACCCG
CAAGGCCAGAACGGGCGATAGCAACAAAAGAAAATATGACACCCGCACGCCTTACGCCAGTACCGAGGTC
TTTGTCTCGTTGGTCGATCAACAAGAGGCTCCTTATGGCGATAGCTTGCGCTACCTCTCTATTGAAGCTC
AGGTGACTAATCGGGATCTTCCGCGCCTGATTTCCGCCAGTGGTAATTTTGAATTGACCATGTCGGATTC
AGCGCCCGTTCACGGTGCCCGGTTTGTCTTCCAACCCAGCGCCCCACGCGCCCCCTTTGCCATGGATGAA
TCCGCCTGGCGTTTGATTCGCCAATTGAGCTTCAACTATCTGCCACTGTCAGATATGTCCCACTCGAATG
GGGGGGAGTCACTGCGCAATATGCTACGTCTGTTTGTTAACGCTTCAGACCATGAATCGAATACACAAAT
TGACGCGCTGGTGGGCTGTAAAAGCGAGCCGGTGATCCGCCGGTTACCCGGCAATGGCCTACTGGTTTAT
GGCCGGGGCATCTGCTGCACTTTGACCGTGGATGAAGAAGGATTCTCCGGTATCAGCCCTTATCTATTTG
GCATGATCATGGAAAATTATGTGGCCCGCCATGCCGCAATAAATGTGTTTACCGAGACCGAGCTAAACTC
CATGCAAAGAGGACGTGTCGGTCATTGGAAAGCCCGCCCTGGCAGACGAGGAGTCCTGTAA