SecReT6
Protein ID: 108811605
SecReT6 ID130
T6SS typei3
Gene symbol-
Locus tagYPN_1442
StrainYersinia pestis Nepal516
Repliconchromosome [GenBank: NC_008149] [Browse all T6SS(s) in this replicon]
Location [Strand]1641971..1642495 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ1CJQ8
KEGG IDypn:YPN_1442
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-59, Aligned region: 11..164
Protein Sequence: 174 a.a.     [Download]
>gi|108811605|ref|YP_647372.1| hypothetical protein YPN_1442 [Yersinia pestis Nepal516]
MVSKSNSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLEPLPSVADRKLLDIDIDNF
DERMKAMKPRVAFAVLNTLTGEGQLMVDITFESMDDFSPDAIAKKVDSLSQLLDARTQLANLQTYMDGKA
GAEELVMKLLKDKSLLTTLASAPKAKQSAVDTPQ
 
Nucleotide Sequence: 525 bp     [Download]
>gi|108810166|ref|NC_008149.1|:1641971-1642495 Yersinia pestis Nepal516 chromosome, complete genome
ATGGTTAGCAAAAGTAATTCTCAAAAGTTTATCGCTCGAAACCGAGCGCCACGCGTGCAGATTGAATACG
ATGTGGAAATATACGGTAGTGAAAAGAAGGTTGAATTACCTTTCGTTATGGGGGTATTAGCAGATTTATC
CGGTAAACCTCTTGAGCCTTTACCTTCAGTCGCTGACAGAAAACTGTTAGATATCGATATTGATAATTTC
GATGAGCGCATGAAAGCAATGAAACCACGTGTTGCATTCGCCGTGCTGAATACATTGACTGGGGAAGGCC
AGTTAATGGTCGATATTACGTTTGAGAGTATGGATGATTTCTCTCCTGACGCTATCGCGAAAAAAGTTGA
TTCATTGTCTCAATTATTAGATGCCCGAACTCAACTTGCCAACTTGCAGACTTATATGGATGGTAAGGCT
GGTGCTGAGGAATTAGTTATGAAATTGCTGAAAGACAAATCATTACTGACAACGCTTGCATCCGCACCGA
AAGCAAAACAATCCGCTGTTGATACTCCACAGTAA