SecReT6
Protein ID: 108811608
SecReT6 ID130
T6SS typei3
Gene symbol-
Locus tagYPN_1445
StrainYersinia pestis Nepal516
Repliconchromosome [GenBank: NC_008149] [Browse all T6SS(s) in this replicon]
Location [Strand]1645085..1645645 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ1CJQ5
KEGG IDypn:YPN_1445
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.00E-36, Aligned region: 29..179
Protein Sequence: 186 a.a.     [Download]
>gi|108811608|ref|YP_647375.1| hypothetical protein YPN_1445 [Yersinia pestis Nepal516]
MILIRLSMNKSIRGVYRATQYLFLVLVTLLTIACSSKVQPEKAEKLTVEIATAADINPNDKGVANPLRIA
LYTLKSTDEFQSSDFFTITEENTPSLKEQMDNVFDRIMLPSETKKIELTLDAGVTAIGIVAAYREIEQAE
WKAVIYPLPKKRVDPWYKKMWPGQDQQDPIMKVRVERLSISIKEMD
 
Nucleotide Sequence: 561 bp     [Download]
>gi|108810166|ref|NC_008149.1|:1645085-1645645 Yersinia pestis Nepal516 chromosome, complete genome
ATGATTTTAATTAGGCTAAGTATGAATAAAAGTATCCGAGGGGTTTACCGGGCGACACAGTACTTATTTT
TGGTACTGGTAACGTTATTGACGATAGCCTGTAGTTCAAAAGTGCAACCTGAAAAGGCTGAAAAGCTTAC
CGTCGAAATCGCGACAGCAGCGGATATTAATCCGAATGATAAAGGGGTGGCGAACCCGCTAAGGATTGCA
CTTTATACACTCAAGAGCACCGATGAATTTCAGTCGAGTGATTTCTTCACTATCACTGAAGAAAATACGC
CATCGCTAAAAGAACAAATGGATAACGTGTTTGACCGGATTATGTTGCCAAGCGAGACCAAAAAAATAGA
GCTGACACTTGATGCTGGCGTTACTGCTATCGGCATCGTGGCTGCTTATCGTGAAATTGAACAGGCGGAG
TGGAAAGCGGTTATTTATCCGTTGCCCAAAAAACGCGTGGATCCTTGGTATAAAAAAATGTGGCCAGGGC
AAGACCAACAAGATCCGATCATGAAGGTACGCGTTGAGCGTCTGTCAATATCAATTAAAGAAATGGATTA
A