SecReT6
Protein ID: 108812652
SecReT6 ID132
T6SS typei2
Gene symbol-
Locus tagYPN_2491
StrainYersinia pestis Nepal516
Repliconchromosome [GenBank: NC_008149] [Browse all T6SS(s) in this replicon]
Location [Strand]2795612..2796292 [-]
Producthypothetical protein
NoteTssJ
UniProt IDQ1CGR1
KEGG IDypn:YPN_2491
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.40E-39, Aligned region: 64..219
Protein Sequence: 226 a.a.     [Download]
>gi|108812652|ref|YP_648419.1| hypothetical protein YPN_2491 [Yersinia pestis Nepal516]
MTRRCQTIYLNILPWRWATTVGWLHSNIKKETDVLTTVWKNKTCTSKHKSWAAWKNKICIPALVLLLSGC
GLTQAVTDSTVSATKSLFYKQIKVLHLDFTAREALNTDAHEANSSSEPVMVRVYQLRDDKTFLKTVYQQL
ASDGEAALKDDLLASRSVVVKPGGAVTLDMPMEKETQFVAVVALFRHPDMAKDHWRLILTLDDLHPDKPR
TLELGNNSLTLRTEKK
 
Nucleotide Sequence: 681 bp     [Download]
>gi|108810166|ref|NC_008149.1|:c2796292-2795612 Yersinia pestis Nepal516 chromosome, complete genome
ATGACGCGACGCTGTCAGACGATATACCTGAATATTTTACCGTGGCGCTGGGCCACTACCGTGGGCTGGC
TCCACAGCAACATCAAGAAGGAAACCGACGTGTTAACTACCGTTTGGAAAAATAAAACCTGTACTTCGAA
ACATAAAAGCTGGGCCGCCTGGAAAAATAAAATCTGCATCCCCGCACTGGTCTTGTTGCTCAGTGGCTGC
GGGCTGACGCAAGCCGTGACCGATAGCACCGTGTCGGCCACAAAATCACTGTTTTATAAGCAGATAAAGG
TGCTGCATCTGGACTTTACCGCCCGTGAAGCCCTGAATACCGATGCGCACGAGGCGAACTCGTCATCGGA
GCCGGTAATGGTGCGGGTTTATCAGTTACGTGATGATAAAACCTTCCTCAAAACGGTGTATCAACAACTG
GCAAGCGACGGGGAGGCGGCGCTTAAAGATGACCTGCTGGCCAGCCGCAGTGTGGTGGTGAAACCGGGCG
GGGCGGTAACACTGGATATGCCGATGGAAAAAGAGACCCAGTTTGTGGCAGTGGTGGCGCTGTTCCGTCA
TCCGGATATGGCCAAAGACCACTGGCGTCTGATACTCACGCTGGACGACCTGCATCCCGATAAGCCCCGT
ACCCTTGAGTTGGGTAATAACAGCCTGACCCTGCGGACGGAGAAAAAATAA