SecReT6
Protein ID: 108812668
SecReT6 ID132
T6SS typei2
Gene symbol-
Locus tagYPN_2507
StrainYersinia pestis Nepal516
Repliconchromosome [GenBank: NC_008149] [Browse all T6SS(s) in this replicon]
Location [Strand]2815550..2817898 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ1CGP5
KEGG IDypn:YPN_2507
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-64, Aligned region: 34..355
DUF2345 [PF10106], Evalue: 1.30E-47, Aligned region: 611..751
T6SS_Vgr [PF13296], Evalue: 4.30E-35, Aligned region: 488..591
T6SS_Vgr [PF13296], Evalue: 4.30E-35, Aligned region: 629..650
Phage_base_V [PF04717], Evalue: 8.80E-16, Aligned region: 390..481
Protein Sequence: 782 a.a.     [Download]
>gi|108812668|ref|YP_648435.1| hypothetical protein YPN_2507 [Yersinia pestis Nepal516]
MNTFLPTIRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDIQFTSADKAIGPATMLMHDASLTLAA
PMAEAFGVTVQQTQRVIQGVVTGFKRLSASKEECRYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILR
ERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFIRRLLAEVGIWFRFTADPKLNIDVVEFYDDQRFYQQ
GLTLQAVPPSGMHDSGMESVWDLSSAHQVVEKSVSTGDYNYRTATADLTAGADITRGDTTTYGEAYHYAD
NYLTAGSEGREPESESGAFYARLRHERYLNNQARFAGVANAAALAPGQELNVTGNDVPAQFGKGVIITRI
TSHARRDRSYEVHFEAIPYSEDYCFRPALIRKPTMAGTLPARVTSTTANDTYGHIDKDGRYRVNLMFDRD
SWESGYESLWVRQARPYAGDSYGLHLPLLAGTEVAIAFEDGNPDRPYIAYVLHDSAHGDHVTISNYKRNV
LRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFELRTDSFGVLRAEKGLFITAD
GQAKAQGQVLEMQPAISLLKSAQEQMEAISADAQTATASPADLQVQISLLQQNLTELKQAVLLLSAPKGI
ALSSGEHLQMSASDNLIATAGKNADVSVAKNFFIGVGNTLSIFVRKLGMKLIANQGPITVQAQNDLMELL
ARKAITITSTEDEIKITAKKRITLNAGGSYITLDENRIESGTAGEYLTKAGYYGRLDKAKLPTEFPALAA
KTEDPIKRWLFS
 
Nucleotide Sequence: 2349 bp     [Download]
>gi|108810166|ref|NC_008149.1|:c2817898-2815550 Yersinia pestis Nepal516 chromosome, complete genome
ATGAATACCTTTCTCCCGACTATTCGGTTTGACCATAGCCACCACAAACTGGTGGTCCGCGACAGCACCG
CCGCCGTTGATGTGCTGGGCTTTGAAGGCCATGAAAGCCTGAGCCAGCCGTTCTGTTACGACATCCAATT
CACCAGCGCCGACAAGGCGATTGGCCCGGCGACCATGCTGATGCACGACGCGTCACTGACATTGGCGGCC
CCGATGGCCGAAGCTTTTGGCGTGACGGTTCAGCAGACCCAGCGGGTGATCCAAGGGGTGGTCACCGGAT
TTAAACGCCTGTCGGCCTCGAAAGAGGAATGCCGCTACGAACTGAGCCTGCAACCGCGCCTGGCCTTGTT
ATCGCGCAGCCATCAGAACGGGATATATCAGGACATGTCGGTGCCGCAGATTGTGGAAAAAATTCTGCGT
GAGCGCCATGACATGCGCGGTCAGGATTTTGTCTTCACGCTGGCCCGCGAGTACCCACGCCGCGAGCAGG
TAATGCAATACGGCGAGGATGACCTGACCTTTATCCGCCGCCTGCTGGCCGAGGTGGGGATCTGGTTTCG
TTTTACCGCCGATCCCAAACTCAATATTGATGTGGTGGAGTTTTACGACGACCAGCGCTTCTATCAGCAA
GGACTGACGCTACAGGCGGTGCCGCCTTCGGGGATGCACGACAGCGGGATGGAATCGGTCTGGGACCTGT
CCAGCGCCCATCAGGTGGTGGAAAAATCGGTCAGTACCGGCGATTACAACTACCGCACCGCCACTGCCGA
CCTGACCGCCGGGGCCGACATCACGCGCGGCGATACCACCACCTACGGCGAAGCCTATCATTACGCCGAT
AACTATCTGACCGCAGGCAGCGAAGGGCGCGAGCCGGAAAGTGAAAGTGGGGCCTTTTATGCCCGTCTGC
GCCATGAACGTTACCTCAATAATCAGGCGCGCTTCGCCGGGGTGGCCAATGCGGCGGCACTGGCACCGGG
TCAGGAACTGAACGTCACCGGCAACGACGTGCCAGCACAGTTTGGTAAAGGGGTGATAATCACCCGCATC
ACCAGCCATGCCCGCCGCGACCGCAGCTATGAAGTACATTTTGAAGCCATTCCTTACTCCGAGGATTATT
GCTTCCGTCCGGCGCTGATCCGCAAGCCGACCATGGCCGGGACCTTGCCGGCGCGGGTGACCAGTACCAC
TGCGAACGACACTTATGGTCATATCGACAAAGACGGGCGCTACCGTGTCAACCTGATGTTCGACCGTGAC
AGTTGGGAGTCGGGTTACGAAAGCTTGTGGGTCCGTCAGGCCCGCCCGTATGCGGGTGACAGCTACGGCC
TGCACCTGCCGCTGCTGGCAGGCACCGAAGTGGCGATCGCGTTTGAAGACGGCAACCCGGACCGGCCGTA
TATCGCCTATGTGCTACACGACTCGGCGCACGGCGACCATGTCACCATCAGCAACTACAAACGCAACGTA
CTGCGTACTCCGTCGAATAACAAACTGCGCCTGGAGGATGAACGGGGTAAAGAGCACATCAAGCTCAGCA
CCGAATATGGCGGCAAAAGCCAACTGAATCTGGGGCATTTGGTTGATAACGAGAAACAGCCTCGGGGTGA
GGGTTTTGAGCTGCGCACCGACAGTTTTGGTGTATTACGGGCAGAAAAAGGCCTCTTTATCACTGCCGAC
GGACAGGCCAAAGCACAGGGGCAGGTGCTGGAGATGCAACCGGCTATCAGCCTGTTGAAAAGTGCGCAGG
AACAGATGGAGGCCATCTCCGCGGATGCACAAACCGCCACCGCCAGTCCGGCCGACCTACAGGTACAAAT
CAGTCTGTTGCAGCAAAATCTCACTGAACTGAAACAAGCTGTCCTGTTACTGAGTGCGCCAAAGGGGATC
GCGTTGAGTAGCGGGGAGCATCTGCAAATGAGTGCCAGCGATAACCTGATTGCCACCGCCGGTAAAAATG
CCGACGTCAGCGTCGCGAAAAATTTCTTTATCGGCGTAGGCAATACCCTAAGTATCTTCGTCAGAAAGCT
GGGGATGAAACTAATAGCCAATCAGGGGCCGATAACAGTCCAGGCGCAGAATGATCTAATGGAGTTATTG
GCGCGTAAAGCGATCACCATTACCAGCACCGAGGATGAGATAAAAATCACCGCCAAGAAGAGGATCACGC
TGAATGCGGGAGGCAGTTATATCACGCTGGATGAGAATCGGATCGAGTCAGGAACGGCGGGGGAATATTT
GACCAAAGCAGGGTATTACGGGCGGTTAGATAAGGCCAAACTCCCAACTGAATTTCCAGCCTTAGCCGCT
AAAACTGAAGACCCCATTAAACGTTGGCTATTCTCTTAA