SecReT6
Protein ID: 108813727
SecReT6 ID134
T6SS typeN/A
Gene symbol-
Locus tagYPN_3567
StrainYersinia pestis Nepal516
Repliconchromosome [GenBank: NC_008149] [Browse all T6SS(s) in this replicon]
Location [Strand]4072766..4073389 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ1CDN6
KEGG IDypn:YPN_3567
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.10E-48, Aligned region: 24..39
DUF3702 [PF12486], Evalue: 2.10E-48, Aligned region: 54..201
Protein Sequence: 207 a.a.     [Download]
>gi|108813727|ref|YP_649494.1| hypothetical protein YPN_3567 [Yersinia pestis Nepal516]
MLWGFGAGVLCSLLVATAVYVTQFKPLQQQMTVLATQPESAALLWLNRPDVATYGEQLSTLENLSPLFVL
NTADQSVAMARQRWPSDPSQVAESQRWARLVEARIGLAGTDSSYFQLQQRLHALSEKLLEQERSRGSLTI
SYLKTAVYQMQTELNREIPLEELLRQLAVSADEHQPASPVLIKQIDDRWNALLSRYHHLTQQTNSAR
 
Nucleotide Sequence: 624 bp     [Download]
>gi|108810166|ref|NC_008149.1|:c4073389-4072766 Yersinia pestis Nepal516 chromosome, complete genome
GTGCTGTGGGGCTTTGGTGCCGGTGTCCTGTGTAGTTTACTGGTGGCGACTGCGGTTTACGTTACCCAGT
TCAAACCGCTGCAACAGCAAATGACGGTGCTGGCCACCCAACCGGAAAGCGCGGCATTGCTGTGGCTCAA
CCGCCCGGATGTCGCCACCTATGGTGAGCAACTGAGCACCCTGGAAAACCTCTCGCCCCTGTTTGTGCTC
AATACCGCCGACCAGTCGGTGGCGATGGCTCGTCAACGCTGGCCGTCCGATCCCAGTCAGGTGGCCGAAA
GCCAGCGCTGGGCGCGGTTGGTGGAGGCGCGTATCGGCCTGGCCGGTACCGACAGCAGCTATTTCCAGCT
CCAGCAGCGCTTGCATGCGCTGTCTGAAAAATTACTCGAACAGGAACGTTCTCGGGGCAGTCTGACCATC
TCCTATCTAAAAACAGCAGTTTACCAGATGCAGACCGAGCTGAACCGGGAGATACCGCTGGAGGAGTTAC
TGCGCCAGTTGGCGGTGTCCGCCGATGAACATCAACCGGCCTCGCCGGTCTTGATAAAACAAATTGATGA
CCGCTGGAATGCCTTACTCAGCCGTTATCACCACTTAACGCAGCAGACGAACTCTGCCCGTTAA