SecReT6
Protein ID: 108813730
SecReT6 ID134
T6SS typeN/A
Gene symbol-
Locus tagYPN_3570
StrainYersinia pestis Nepal516
Repliconchromosome [GenBank: NC_008149] [Browse all T6SS(s) in this replicon]
Location [Strand]4077768..4079156 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ1CDN3
KEGG IDypn:YPN_3570
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.30E-16, Aligned region: 53..112
DUF1020 [PF06255], Evalue: 0.01, Aligned region: 111..144
Protein Sequence: 462 a.a.     [Download]
>gi|108813730|ref|YP_649497.1| hypothetical protein YPN_3570 [Yersinia pestis Nepal516]
MDITSQHPWHVLLQAPLSPEQTAQALADDDPQWEYIDGQMVKLGSLAHATLNIDDIQQQAMALLSQKSKD
FRLVVHLLRTLQHGGQPDELMLAMSLLTEYVQLFWTTAWPQNPLHKRRFAQQILKRFDSASSSFSQRADE
AQRENVQGLLAHLAQVWHSREPGLAKEVDALRSRYARPPERVIEAVASDEPLSSNTLAAAMAATPVSPSL
AIDNTSDRAWRQTLLKMADLLSEQQPDAAIGFRLRRHAVWGALTAPPMAQSDGRTPLAAVSADRTADYLA
RLANADLPLWHQVEQSLTLAPYWLDGHVLSAQIALQLGYDAVAQAIRDELSVFLARIPALKTLFFTDMTP
FLSSESAAWLQQDANHQGRSRTIEQDEIWQCYQQQGLEAALQMINRQPQQSEPRDRFYHQLLSAQLFEKA
GLTALAQQHYHSLLLVGQQLQLSEWEPALIALLTEKQRQLKP
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|108810166|ref|NC_008149.1|:c4079156-4077768 Yersinia pestis Nepal516 chromosome, complete genome
ATGGATATCACGTCACAACATCCCTGGCATGTCTTGTTACAAGCCCCTTTGTCACCTGAGCAGACCGCAC
AAGCCCTGGCCGATGATGACCCCCAATGGGAATATATCGACGGCCAGATGGTGAAACTGGGGTCATTGGC
CCACGCCACGCTGAATATTGATGATATTCAGCAACAAGCCATGGCGCTGTTATCACAGAAAAGTAAAGAC
TTCCGGCTCGTGGTGCATCTACTGCGCACCCTACAACACGGGGGCCAGCCAGATGAATTAATGCTGGCGA
TGTCGTTGCTGACCGAATACGTCCAGCTATTTTGGACTACGGCCTGGCCGCAAAATCCTTTACACAAACG
GCGCTTTGCTCAACAAATCCTAAAACGCTTTGACAGCGCCAGCAGCAGTTTTAGCCAACGAGCGGACGAG
GCTCAACGTGAGAATGTGCAAGGATTATTGGCACATTTAGCACAGGTTTGGCATAGCCGTGAGCCGGGTC
TGGCTAAAGAGGTGGATGCATTACGCAGCCGCTATGCGCGGCCACCGGAGCGGGTTATCGAGGCAGTGGC
TTCTGATGAACCGCTCTCATCCAACACCTTGGCGGCGGCAATGGCCGCCACCCCCGTTAGCCCAAGCCTC
GCCATAGATAACACGAGCGACAGAGCCTGGCGGCAGACCTTGCTGAAAATGGCGGATCTACTCAGCGAAC
AGCAACCCGATGCCGCTATCGGTTTCCGGCTACGCCGCCATGCCGTATGGGGCGCGTTAACCGCACCACC
TATGGCGCAGAGCGATGGCCGCACCCCGTTAGCCGCGGTATCTGCGGATCGAACCGCCGATTACTTAGCA
CGTCTGGCTAATGCCGATTTGCCTTTGTGGCACCAAGTGGAGCAGAGCCTCACCCTCGCGCCTTATTGGC
TGGATGGACATGTGCTTTCGGCACAAATCGCCCTGCAACTGGGTTATGACGCGGTGGCACAGGCTATCCG
TGATGAACTCAGCGTTTTTTTAGCCCGTATTCCCGCATTAAAAACCCTCTTTTTTACGGATATGACGCCA
TTCCTCTCCTCTGAATCTGCCGCCTGGTTACAGCAGGATGCGAATCATCAGGGAAGAAGTCGCACTATTG
AACAGGATGAAATTTGGCAATGCTATCAACAGCAAGGATTGGAAGCCGCACTACAGATGATAAACCGGCA
ACCACAGCAATCCGAACCTCGGGACCGTTTTTACCATCAATTGCTCAGTGCACAGTTGTTCGAAAAAGCA
GGGTTAACCGCATTGGCGCAGCAGCACTACCACAGCTTATTACTGGTAGGGCAGCAATTACAGCTAAGCG
AATGGGAACCTGCGTTGATCGCTCTACTGACAGAAAAACAGCGACAACTCAAACCATGA