SecReT6
Protein ID: 108813734
SecReT6 ID134
T6SS typeN/A
Gene symbol-
Locus tagYPN_3574
StrainYersinia pestis Nepal516
Repliconchromosome [GenBank: NC_008149] [Browse all T6SS(s) in this replicon]
Location [Strand]4083253..4084020 [-]
Productmembrane protein
NoteTssL
UniProt IDQ1CDM9
KEGG IDypn:YPN_3574
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.30E-63, Aligned region: 34..239
Protein Sequence: 255 a.a.     [Download]
>gi|108813734|ref|YP_649501.1| membrane protein [Yersinia pestis Nepal516]
MKTDAVTDNTPFPAAEAVTSHRQYQLPLRGESLNAMIDTATPLLGMVLRLKDMENQALPDQLYQQVVTDI
RAIEQYLQTKGYEPGAIISFRYVLCTFIDETALGHGWNTQNGWLQQSLLVHFHNETWGGEKVYVLLERLM
GEPKRYQDLLEFIYLCFCLGYRGRYKVTSQNGDDFERLFRRLHHQLQQLRGDAPPTVLYQGGGRLNSRYH
LSKRLTIKHLLWGGVSLLVVIYLFYAIHLHTQSQDILQQLNNLLS
 
Nucleotide Sequence: 768 bp     [Download]
>gi|108810166|ref|NC_008149.1|:c4084020-4083253 Yersinia pestis Nepal516 chromosome, complete genome
ATGAAAACAGATGCTGTGACTGACAACACCCCTTTCCCCGCAGCGGAAGCGGTCACCTCCCATCGGCAGT
ATCAGCTACCGCTACGTGGCGAAAGCTTGAACGCGATGATCGATACCGCCACCCCATTATTGGGGATGGT
ACTGCGCCTGAAAGACATGGAAAACCAAGCGTTACCGGACCAGCTATATCAGCAGGTGGTGACGGATATC
CGTGCTATTGAGCAGTACTTGCAAACCAAAGGCTACGAACCCGGCGCAATCATATCTTTCCGATATGTGC
TGTGCACATTCATCGATGAAACGGCATTAGGGCATGGCTGGAACACCCAAAACGGTTGGTTACAGCAATC
TCTGTTGGTGCATTTTCATAATGAAACCTGGGGCGGAGAGAAAGTGTACGTCCTGCTGGAACGCTTAATG
GGGGAACCCAAGCGTTACCAAGACCTGCTGGAGTTTATCTATCTCTGTTTTTGTTTGGGTTACCGCGGCC
GCTACAAAGTGACATCACAAAACGGTGATGACTTTGAGCGATTGTTCCGCCGATTGCATCATCAATTACA
GCAGTTACGGGGTGATGCGCCGCCGACGGTCCTTTATCAAGGGGGCGGTCGTCTGAATAGCCGCTACCAC
TTGAGTAAACGGTTGACTATCAAGCATTTGTTATGGGGTGGCGTGAGTCTGCTGGTGGTGATTTATCTGT
TTTATGCCATCCACCTGCACACCCAAAGTCAGGATATTTTGCAACAGCTAAACAATTTATTGAGCTAG