SecReT6
Protein ID: 108813736
SecReT6 ID134
T6SS typeN/A
Gene symbol-
Locus tagYPN_3576
StrainYersinia pestis Nepal516
Repliconchromosome [GenBank: NC_008149] [Browse all T6SS(s) in this replicon]
Location [Strand]4085369..4085914 [-]
Productlipoprotein
NoteTssJ
UniProt IDQ1CDM7
KEGG IDypn:YPN_3576
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.60E-36, Aligned region: 17..174
Protein Sequence: 181 a.a.     [Download]
>gi|108813736|ref|YP_649503.1| lipoprotein [Yersinia pestis Nepal516]
MNNARGYLLTWALCVVFLLSGCSGAWEATKKVGKVVMDPDIPVGQATDQPSTVRLTLLSDPDTNPNEKGE
AVPTEIVVVYLSENSKLLAADYDQLSSDALEKTLGKNYIDHQEYTLLPDQFKALDPIKLEEKNSYLGVIA
HYADANRSEWKKIIKIKGIGHNYQVLVHVRSNDVDLRKEEE
 
Nucleotide Sequence: 546 bp     [Download]
>gi|108810166|ref|NC_008149.1|:c4085914-4085369 Yersinia pestis Nepal516 chromosome, complete genome
ATGAACAACGCCAGAGGCTATCTCCTGACGTGGGCATTATGTGTGGTGTTCCTGTTGTCTGGGTGCAGCG
GTGCATGGGAAGCCACTAAAAAGGTCGGCAAGGTGGTTATGGACCCTGATATTCCGGTGGGGCAGGCTAC
CGATCAACCCTCAACGGTCAGGCTAACATTGCTGTCCGATCCCGATACCAACCCTAATGAAAAAGGGGAA
GCGGTACCGACTGAGATAGTGGTGGTGTACCTAAGTGAAAACTCCAAGCTGCTGGCCGCGGATTATGATC
AGCTAAGCAGTGACGCGTTGGAGAAAACGCTGGGTAAGAATTACATCGATCATCAGGAATACACCTTACT
GCCCGATCAATTCAAGGCGCTGGACCCTATCAAGCTGGAAGAGAAAAACAGCTATCTGGGGGTGATTGCT
CACTATGCCGATGCCAACCGCAGTGAATGGAAGAAGATCATCAAAATAAAAGGGATCGGCCATAACTACC
AGGTTTTGGTCCATGTCAGATCAAACGATGTCGATCTAAGGAAAGAGGAAGAATAA