SecReT6
Protein ID: 108813737
SecReT6 ID134
T6SS typeN/A
Gene symbol-
Locus tagYPN_3577
StrainYersinia pestis Nepal516
Repliconchromosome [GenBank: NC_008149] [Browse all T6SS(s) in this replicon]
Location [Strand]4085914..4087230 [-]
Producthypothetical protein
NoteFha
UniProt IDQ1CDM6
KEGG IDypn:YPN_3577
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.0047, Aligned region: 34..100
FHA [PF00498], Evalue: 0.0047, Aligned region: 224..239
Protein Sequence: 438 a.a.     [Download]
>gi|108813737|ref|YP_649504.1| hypothetical protein YPN_3577 [Yersinia pestis Nepal516]
MDKKQPTLSLRVVNSDKLESGKQASSLFHTQGGSVGSDGSHHWSIQDQGGNISPSQFAIEWRDGSFCLRM
LNGSLNINHSMLTPNSGFVRLQQGDEMTLGNLVIKSHISRSAADMIDPLMVSPESLVSSYSNPMDAMMEG
EPLASPHHQQDSRLAATVSHNFSHDPLRVLETESLTTQGHDAVISDADHSLQQDRYRNPLFSSPLSDTPK
DSAMDQAFIDLPQISTFLNGKQAGGKPEGLNNQMEQHHVAITPLMRGFDAQLPIRNSQEAHDFLEEAGKT
LKATIEGLLALQRSQHGLRDKHLRPIEDNPLRLNMDYDTTLNLMFADQKSPVHLSAPAAVAESLDNLRLH
HQANQQAITQALNTMLEAFSPERLLTRFTHYLRSNERQEQDSAWAWDMYKNYYNELASSRQQGFEKLFGE
VYEQAYDRALRQGMKDSE
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|108810166|ref|NC_008149.1|:c4087230-4085914 Yersinia pestis Nepal516 chromosome, complete genome
ATGGATAAAAAACAACCAACGCTGTCATTGCGGGTCGTCAACAGCGATAAATTAGAGAGTGGCAAACAAG
CCAGCAGCCTGTTTCATACGCAAGGGGGCAGTGTCGGCAGTGACGGTAGCCATCATTGGTCGATTCAGGA
CCAAGGCGGCAATATCAGCCCGTCACAGTTTGCTATTGAATGGCGTGATGGCTCTTTCTGCCTGCGGATG
CTGAATGGCTCTCTGAACATTAATCATTCGATGCTGACACCCAATTCGGGTTTCGTTCGCCTACAGCAAG
GGGATGAAATGACGTTGGGTAATCTGGTGATCAAAAGCCATATCAGCCGTTCTGCTGCCGATATGATCGA
TCCACTGATGGTGTCACCGGAGTCACTGGTATCGAGTTACAGCAACCCGATGGATGCCATGATGGAAGGG
GAGCCGTTGGCCTCGCCTCATCATCAGCAAGACAGCCGGTTAGCCGCGACGGTTAGCCATAATTTCAGCC
ATGATCCATTGCGGGTATTGGAAACTGAAAGCCTGACCACGCAAGGCCATGACGCCGTGATATCTGATGC
TGATCACTCTCTACAGCAGGACCGATACCGTAACCCACTTTTCTCTTCCCCGCTCTCTGATACCCCCAAG
GACAGTGCTATGGATCAGGCGTTTATCGATCTCCCGCAGATCAGTACCTTTCTTAACGGTAAACAAGCGG
GGGGCAAACCAGAAGGATTAAATAACCAAATGGAACAACATCACGTTGCCATTACGCCGCTGATGCGTGG
TTTTGACGCTCAACTCCCGATCCGCAACAGCCAGGAAGCTCACGATTTCCTTGAAGAGGCGGGTAAAACA
CTCAAAGCGACAATCGAAGGTCTGCTCGCCTTACAACGCAGCCAACATGGCTTGCGTGATAAGCACTTAC
GGCCGATTGAAGATAATCCATTGCGTCTGAATATGGATTACGACACCACCCTCAACTTGATGTTTGCCGA
TCAAAAAAGCCCGGTTCATCTTTCAGCGCCCGCCGCCGTGGCCGAAAGCCTGGATAACCTGCGTTTGCAT
CATCAGGCCAATCAACAGGCGATTACGCAAGCCTTGAACACCATGTTGGAAGCCTTCTCCCCTGAGCGTT
TACTGACGCGTTTTACCCATTATTTGCGCAGTAATGAGCGGCAAGAGCAGGACTCCGCCTGGGCGTGGGA
TATGTACAAAAACTACTATAACGAGCTGGCCTCCAGCCGCCAGCAAGGTTTTGAAAAACTGTTTGGCGAA
GTGTATGAGCAAGCCTATGACCGGGCCTTACGTCAAGGCATGAAGGATAGCGAGTAA