SecReT6
Protein ID: 108813739
SecReT6 ID134
T6SS typeN/A
Gene symbol-
Locus tagYPN_3579
StrainYersinia pestis Nepal516
Repliconchromosome [GenBank: NC_008149] [Browse all T6SS(s) in this replicon]
Location [Strand]4088408..4089151 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ1CDM4
KEGG IDypn:YPN_3579
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.00E-73, Aligned region: 4..247
Protein Sequence: 247 a.a.     [Download]
>gi|108813739|ref|YP_649506.1| hypothetical protein YPN_3579 [Yersinia pestis Nepal516]
MHRGHGREYTSFESFHHQIEHSQEKTALYYRLRVKNSLFRKGFEHYISFVRSDESKLVLAEENVSVSLTC
TNRELPLSLRVGDINQLSTDSPSFATFRNITRPSVPLYPVLDGGLHWSLLSNMSLNYMSLLDKDALKQIL
HTYDFPSLHNRQSARASQKKLDAIQRIETQPIDRLFRGLPVRGLQTTLWLEQGAFSSEGELYLFSTVLAR
FFSLYASVNAFHLLKVINLDNQECYEWPVQTGQHALM
 
Nucleotide Sequence: 744 bp     [Download]
>gi|108810166|ref|NC_008149.1|:c4089151-4088408 Yersinia pestis Nepal516 chromosome, complete genome
GTGCACCGGGGTCATGGCCGGGAGTACACCTCGTTTGAGAGCTTCCACCATCAGATCGAACACTCGCAAG
AAAAGACCGCACTTTATTACCGCCTACGTGTGAAAAATTCATTATTCCGTAAGGGATTCGAACACTACAT
TTCCTTTGTTCGCAGTGATGAATCGAAGCTGGTGCTTGCTGAAGAGAATGTCTCGGTCAGCCTGACGTGC
ACCAACCGTGAGTTGCCGCTGTCGTTGCGCGTTGGTGATATCAATCAACTCAGCACAGACAGCCCTTCAT
TCGCGACGTTCCGCAATATTACCCGTCCTTCCGTGCCGTTGTATCCGGTGCTGGATGGGGGCCTGCATTG
GTCATTGCTCTCCAATATGTCGTTGAACTACATGTCCTTACTGGATAAGGACGCGTTGAAGCAAATTCTG
CATACCTATGATTTCCCAAGCCTGCATAACCGGCAATCAGCCAGGGCATCGCAAAAGAAACTGGACGCTA
TCCAACGTATTGAAACACAACCGATTGACCGGTTGTTTCGTGGCTTACCTGTCAGAGGGCTACAAACCAC
GCTATGGCTGGAGCAAGGCGCTTTTAGCTCTGAAGGCGAGCTTTATCTCTTCAGCACGGTATTAGCTCGC
TTCTTCTCACTGTATGCCAGCGTCAATGCGTTTCATCTTTTAAAAGTCATCAATCTTGATAATCAGGAAT
GTTACGAATGGCCGGTACAGACAGGTCAACATGCACTGATGTAA