SecReT6
Protein ID: 110277124
SecReT6 ID788
T6SS typei1
Gene symbolvgrG2
Locus tag110277124
StrainAeromonas hydrophila SSU
Repliconchromosome [GenBank: DQ667172] [Browse all T6SS(s) in this replicon]
Location [Strand]1004..3049 [+]
ProductVgrG-2 protein
NoteTssI
UniProt IDQ0PZH5, Q0PZH5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-67, Aligned region: 30..326
Phage_base_V [PF04717], Evalue: 3.80E-24, Aligned region: 372..465
DUF2345 [PF10106], Evalue: 0.0071, Aligned region: 570..619
Protein Sequence: 681 a.a.     [Download]
>gi|110277124|ref|ABG57133.1| VgrG-2 protein [Aeromonas hydrophila]
MADSTGLQFTVKVGALPENTFVVAEFALDEALNRPFNLRLELASAQPDIDFGAVLDQPCELLVWYNGELQ
RRVCGVVSDFAQGDSGFRRTRYQLMVQPALWRLSLRQNSRIFQAQKPDEILSILLQEHGITDYAFALKNE
HAKREYCVQYRETGLDFVNRLAAEEGMFYFHEFEVGKHRIVFADDSAALTAGPELFFNLGNRSLEQGPYV
RQFHYREAVRPSDVELKDYSFKTPAYGLSHKKVGAELTHQRDTYQHFDFPGRYKEDPSGKAFAQHRLDAL
RNDAVAGSGKSNSSALQPGQTFSLTEHPNDSLNTDWQIVRIQHTGLQSQALEEEGGSGPTVYHNEFGVVK
ASTTWRARIGSPEAPHKPMVDGPQIAVVVGPEGEEIYCDEHGRVKLQFPWDRYGSSNDQSSCWVRVSQGW
AGGQYGMMAIPRIGHEVIVSFLEGDPDQPIVTGRTYHATNRPPYELPANKTRTVLRTETHQGEGFNELRF
EDQAGKEEIYIHGQKDLNVLIENDAAWHIKHDQHTDIDNERVTRIKANDHLTVEGEKRDQIKADYSLTVD
ASLHQKLGQSLLVEAGSEVHHKAGMKIVMEAGAELTLKVGGSFVKIDPSGVTLSGGSIKMNSGGSPGSGS
GWAGQMPIQPGAVEVVAPPPPMDPARQIATLKSAEPVCEICEQLARQEGGG
 
Nucleotide Sequence: 2046 bp     [Download]
>gi|110277122|gb|DQ667172|vgrG2|:1004-3049
ATGGCAGACAGCACAGGATTACAATTTACCGTCAAGGTGGGGGCTCTGCCCGAAAACACCTTCGTGGTGG
CCGAGTTTGCGCTTGATGAAGCGCTGAACCGGCCGTTCAACCTGCGCCTGGAGCTGGCAAGCGCCCAGCC
CGACATCGACTTTGGCGCCGTGCTGGACCAGCCGTGCGAGCTGCTGGTGTGGTACAACGGCGAGCTGCAG
CGTCGGGTATGCGGGGTGGTCAGTGACTTCGCGCAAGGGGACAGCGGCTTTCGCCGCACCCGCTATCAGC
TCATGGTGCAGCCTGCCCTGTGGCGGCTGTCACTTCGCCAGAACTCCCGCATCTTCCAGGCGCAGAAGCC
CGATGAAATCCTCAGCATTCTTCTGCAAGAGCATGGCATCACCGACTACGCCTTTGCCCTGAAAAACGAG
CATGCCAAGCGGGAATATTGTGTTCAGTACCGGGAAACAGGCCTCGATTTCGTGAACCGCCTCGCCGCCG
AAGAGGGGATGTTCTATTTCCACGAGTTTGAAGTGGGCAAGCACCGCATCGTGTTTGCCGATGACTCAGC
CGCCCTGACCGCCGGCCCCGAGCTCTTCTTCAACCTCGGCAACCGCTCGCTGGAGCAGGGCCCCTATGTG
CGGCAGTTCCACTACCGGGAGGCGGTGCGCCCGTCGGATGTGGAGCTCAAGGACTACAGCTTCAAGACCC
CGGCCTACGGCCTCTCCCACAAGAAGGTGGGAGCTGAGCTGACCCACCAGCGCGATACTTACCAGCACTT
CGATTTTCCAGGTCGCTACAAAGAAGACCCGAGCGGCAAGGCCTTTGCCCAGCACAGGCTCGATGCGCTG
CGCAACGATGCGGTAGCCGGTAGTGGCAAGTCCAATAGCTCAGCCCTGCAGCCGGGGCAGACCTTCTCGC
TCACCGAACACCCCAATGACAGCCTCAACACCGACTGGCAAATCGTACGCATCCAGCACACCGGCTTGCA
GTCACAGGCGCTGGAAGAGGAGGGGGGCAGTGGCCCCACCGTCTATCACAACGAATTTGGCGTGGTGAAA
GCCAGCACCACCTGGCGGGCGCGCATCGGCAGCCCGGAGGCCCCTCACAAACCCATGGTGGATGGCCCGC
AAATTGCCGTGGTGGTGGGGCCCGAAGGGGAGGAGATTTACTGCGACGAACATGGCCGGGTGAAACTGCA
ATTCCCGTGGGACAGATATGGCAGCTCCAACGACCAGAGCTCCTGCTGGGTGCGAGTCTCGCAAGGCTGG
GCCGGCGGTCAGTACGGCATGATGGCCATCCCGCGCATTGGCCACGAGGTCATTGTCTCGTTTCTGGAGG
GGGACCCGGACCAGCCCATCGTGACCGGTCGCACCTATCACGCCACCAACCGCCCGCCCTACGAGCTGCC
TGCCAACAAGACCCGTACCGTGCTGCGCACCGAGACCCACCAGGGTGAGGGTTTCAACGAACTGCGTTTT
GAGGACCAGGCGGGCAAGGAAGAGATCTATATCCACGGTCAGAAAGATCTGAACGTGTTGATAGAGAACG
ATGCGGCCTGGCATATCAAACACGACCAGCACACCGATATCGACAACGAGCGGGTGACTCGTATCAAGGC
CAACGATCACCTGACGGTGGAGGGTGAGAAGCGCGACCAGATAAAAGCCGACTACTCGCTGACAGTGGAT
GCCAGCCTGCACCAGAAGTTGGGGCAGTCCCTGCTGGTGGAGGCGGGGTCCGAGGTACATCACAAGGCGG
GTATGAAGATCGTGATGGAAGCGGGGGCTGAGCTTACCCTCAAGGTGGGGGGGAGTTTTGTCAAAATCGA
TCCGAGTGGCGTCACTCTCTCAGGCGGCTCCATCAAGATGAACTCTGGCGGCAGCCCGGGCTCTGGCTCC
GGTTGGGCCGGGCAGATGCCGATCCAGCCCGGTGCGGTTGAAGTGGTGGCGCCACCGCCTCCCATGGACC
CCGCACGTCAGATTGCGACGCTCAAGTCTGCCGAACCTGTGTGCGAGATCTGTGAGCAACTGGCCAGACA
GGAGGGTGGTGGCTGA