SecReT6
Protein ID: 110277128
SecReT6 ID788
T6SS typei1
Gene symbol-
Locus tag110277128
StrainAeromonas hydrophila SSU
Repliconchromosome [GenBank: DQ667172] [Browse all T6SS(s) in this replicon]
Location [Strand]5638..6069 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ0PZH1, Q0PZH1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.40E-22, Aligned region: 32..123
Protein Sequence: 143 a.a.     [Download]
>gi|110277128|ref|ABG57137.1| hypothetical protein [Aeromonas hydrophila]
MPHLSSWDRGNAASLFDRIRGEGLGSSPRSEVDELVDSVKRQLDQILNTRPGNCRSAPDLGVIDLNDATQ
GSADIKGRIREAIRQCIRRYEPRIIHVDVRSPDYQASPLEMSFQVTAHVRLEHIEQVTSFNVHMDSHRHY
RMV
 
Nucleotide Sequence: 432 bp     [Download]
>gi|110277122|gb|DQ667172|:5638-6069
ATGCCGCATCTCTCTTCCTGGGATAGAGGAAATGCGGCCAGCCTGTTTGATCGCATCCGGGGGGAGGGGC
TTGGCTCCTCCCCTCGTTCGGAAGTTGATGAACTGGTCGACTCTGTCAAACGGCAGCTCGACCAGATCCT
CAACACCCGTCCCGGCAATTGCCGCAGTGCACCCGATCTGGGGGTCATTGATCTCAATGACGCCACTCAG
GGCAGTGCGGATATCAAAGGACGGATCCGGGAAGCGATCCGGCAATGCATCCGCCGTTATGAACCGCGGA
TCATCCATGTGGATGTTCGTTCACCGGACTATCAGGCGAGCCCGCTTGAGATGTCGTTTCAGGTGACGGC
CCACGTGCGGCTGGAGCATATCGAGCAAGTTACCTCGTTCAACGTCCATATGGACAGTCACCGTCACTAC
CGCATGGTCTGA